Flavobacterium sp. SLB02: GIY83_17565 Help Entry GIY83_17565       CDS       T10548                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism flz  Flavobacterium sp. SLB02 Pathway flz00670   One carbon pool by folate flz00790   Folate biosynthesis flz01100   Metabolic pathways flz01240   Biosynthesis of cofactors flz04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:flz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GIY83_17565    00670 One carbon pool by folate     GIY83_17565  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     GIY83_17565 Enzymes [BR:flz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      GIY83_17565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QGK75816 Position 4700670..4701152 Genome browser AA seq 160 aa AA seqDB search MIIMIAAVAENNELGKNNELVWHLPNDFKRFKSLTTNHHIIMGRKTFESFPKPLPNRVHI VITRQKDYHPEGCIVVDSIEKAIAACPENEDSYIIGGGEIYNLALPYTDIIEITKVHHTF EADAFFPKISKSEWQLVESEENFKDDKHLFDYTYETYIRK NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattataatgatagcggctgttgccgaaaataacgaacttggaaaaaacaatgaatta gtttggcatttgccaaatgattttaaaagattcaaatcacttacaacgaatcatcatatt attatgggaagaaaaacttttgaaagttttccgaaaccacttccaaacagagttcatatt gtaataacacgtcaaaaagattatcatcctgaaggctgcatcgtagtcgatagtatcgaa aaagcaattgctgcttgtcctgaaaacgaagattcgtatatcattggcggaggcgaaatt tataatcttgccttgccttataccgatattattgagatcaccaaagttcatcatactttt gaagcagatgctttttttccgaaaatcagcaaaagcgaatggcaactggtagaatctgaa gaaaattttaaagatgacaaacatctttttgattatacgtacgaaacatacattagaaag taa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (1) Pfam (1) All databases (2) Download RDF

DBGET integrated database retrieval system