KEGG   Ferroglobus placidus: Ferp_2544
Entry
Ferp_2544         CDS       T01172                                 

Name
(GenBank) flavin reductase domain protein FMN-binding protein
  KO
K18915  ferric-chelate reductase [NAD(P)H] [EC:1.16.1.10]
Organism
fpl  Ferroglobus placidus
Brite
KEGG Orthology (KO) [BR:fpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ferp_2544
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.10  ferric-chelate reductase [NAD(P)H]
     Ferp_2544
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: ADC66649
UniProt: D3S2T7
Position
2175869..2176381
AA seq 170 aa
MDPRAFYKISYGLYVVSSSYNGRLSGQIANTVFQVSSEPPMIAACLNKKNFTHEIVKSSK
VFAVSVLEAETPLTFIGRFGFRSSRDFDKFEGVDYEIGVTGAPVVIQHATAIFEAKVVKE
CDVGTHTLFIGEVVRAELRRDAEVLTYADYHRIKKGKTPKTATVYFDKQS
NT seq 513 nt   +upstreamnt  +downstreamnt
atggatccgagagcgttttataaaataagttacggactttacgtcgtttcctcctcctac
aatggtagactgagcgggcaaattgccaatacagtttttcaggtctcctcagagcctccg
atgattgcagcttgtttgaacaagaaaaacttcacccacgaaatagtgaagtcgagtaag
gttttcgctgttagcgttttggaagctgaaacgccactgacgttcataggaaggtttggg
ttcagaagtagcagggacttcgacaagtttgaaggagtggattacgaaataggagtaact
ggcgctccagtcgtaattcagcatgcaacagcaattttcgaggcaaaggtcgttaaggag
tgcgacgttggaactcacaccttgtttatcggtgaagtcgtgagggctgagctgagaaga
gatgccgaagttttgacttacgccgactaccatcggattaagaaaggaaaaactccgaaa
actgctaccgtttacttcgataagcaaagttag

DBGET integrated database retrieval system