Galbibacter sp. BG1: HX109_05145 Help Entry HX109_05145       CDS       T06675                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gaa  Galbibacter sp. BG1 Pathway gaa00790   Folate biosynthesis gaa01100   Metabolic pathways gaa01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:gaa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HX109_05145 (folB) Enzymes [BR:gaa01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HX109_05145 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HX109_05145 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HX109_05145 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB HTH_37 Motif Other DBs NCBI-ProteinID:  QLE00979 Position complement(1186559..1186915) Genome browser AA seq 118 aa AA seqDB search MGIIKVTNIQVYAYHGCLVEEGKIGSDYRVDVEVKANLQPSAESDQLKDTVDYVQINRIV KEEMAIRSKLLEHVAKRIIDRILKEIEIANEVTVEVSKINPPIGGNVEQVTIQMTLNR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt ttgggaataataaaagtaaccaatattcaagtgtatgcttaccatggatgtttggtagag gaaggtaaaataggtagcgattaccgagttgatgtggaggtaaaagccaatttacaaccc tctgcggaaagtgaccaattaaaagatacggtagattatgtgcaaataaaccgcattgta aaagaggaaatggccatacgctctaaattgttggagcatgtggcaaaaagaattatcgac cgaatcttaaaggagattgaaattgcgaatgaagtaaccgtagaagtttctaaaatcaat ccgcctataggtggtaatgtagagcaggtaaccatacagatgaccctaaatagataa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (2) Pfam (2) All databases (3) Download RDF

DBGET integrated database retrieval system