KEGG   Immundisolibacter cernigliae: PG2T_11410
Entry
PG2T_11410        CDS       T04454                                 

Definition
(GenBank) disulfide bond formation protein DsbA
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00626  Naphthalene degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PG2T_11410
Enzymes [BR:gbi01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     PG2T_11410
SSDB
Motif
Pfam: DSBA Thioredoxin_5
Other DBs
NCBI-ProteinID: ANX04712
UniProt: A0A1B1YVA9
Position
2398016..2398615
AA seq 199 aa
MASKVIDFYIDFTSPFTYLCNLKLPDLAARYGYQLNYHPIDIPTAKLAAGNYGPSNRQVP
AKIRALMQDLNRWAAHYGVPFTFPKGLNAWRMNIGTFYAIEKGKARHYVDEAYRLVWADG
VDPNDDAVLRGLAKTVGLDADAFMAYVSSREGEKAYEASRVAAHARGVYGVPIMMVDDQI
WWGNDRLMFVEEYLKAHAA
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgtcaaaggtgattgatttttatattgatttcacaagtccgttcacgtatctgtgc
aatctcaagttgccggatctggccgccaggtacggttaccagctcaattaccacccgatc
gacattccgaccgccaagctggcggcgggtaactacggcccttccaaccgtcaggtgccg
gccaagattcgtgccctgatgcaggacctgaatcgctgggcggcgcactatggtgtgccg
ttcacgttccccaagggcctgaacgcctggcgcatgaacatcggcacgttttacgccatt
gaaaaaggcaaggcgcgccactatgtggacgaggcctatcgcctggtctgggcggacggc
gtcgatccgaacgacgatgccgtgctgcgcggacttgccaagacggtgggtctggatgcc
gacgccttcatggcgtatgtgtcctcccgcgagggcgaaaaggcatacgaggcatcgcgg
gtcgcggcgcacgcccggggcgtgtacggggtgccgatcatgatggtcgacgaccagata
tggtggggcaacgaccggttgatgtttgtcgaggaatacctcaaggctcacgccgcctga

DBGET integrated database retrieval system