KEGG   Gramella forsetii: GFO_0135
Entry
GFO_0135          CDS       T00448                                 

Symbol
rpsI
Name
(GenBank) 30S ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_0135 (rpsI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_0135 (rpsI)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_0135 (rpsI)
  Bacteria
    GFO_0135 (rpsI)
  Archaea
    GFO_0135 (rpsI)
SSDB
Motif
Pfam: Ribosomal_S9
Other DBs
NCBI-ProteinID: CAL65124
UniProt: A0LXM9
Position
complement(163451..163837)
AA seq 128 aa
MEVIHKIGRRKTAVARVYVSEGKGNITVNKKDLKDYFTTGTLLYKVNQPMMLTENEGNFD
VKINVYGGGITGQAEAIRLALSRAMVALDEENHGALKPEGLLTRDPRMVERKKYGQKKAR
KKFQFSKR
NT seq 387 nt   +upstreamnt  +downstreamnt
atggaggtaattcacaaaattggccgtagaaaaacagctgtggcccgtgtatatgtttca
gaaggaaaaggaaacattaccgtaaacaagaaagaccttaaagattacttcactactggt
acacttttatacaaagtaaaccagccaatgatgcttaccgaaaatgaaggaaacttcgac
gttaaaatcaacgtttacggtggaggtatcactggacaggctgaagcgatccgtcttgca
ctttccagagctatggtagcgctagacgaagaaaaccatggtgctcttaagccagaaggt
cttcttacaagggatccacgtatggtagaacgtaagaaatacggtcagaagaaagcccgt
aagaaattccagttctctaaacgttaa

DBGET integrated database retrieval system