KEGG   Gramella forsetii: GFO_0382
Entry
GFO_0382          CDS       T00448                                 

Symbol
rpsO
Name
(GenBank) 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_0382 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_0382 (rpsO)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_0382 (rpsO)
  Bacteria
    GFO_0382 (rpsO)
  Archaea
    GFO_0382 (rpsO)
SSDB
Motif
Pfam: Ribosomal_S15 FACT-Spt16_Nlob
Other DBs
NCBI-ProteinID: CAL65367
UniProt: A0LYC2
Position
complement(444827..445096)
AA seq 89 aa
MYLTSEKKEEIFSKHGKGKNDTGSAEGQIALFTHRIAHLSEHLKTNRKDYNTERSLVMLV
GKRRSLLDYLMKKDIIRYRAIVKELGLRK
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtatttaactagtgaaaaaaaagaagagatcttctcaaagcatggtaaaggtaaaaac
gataccggttctgctgaaggacagattgcattgtttactcaccgaattgcccacttatca
gaacacctgaaaacaaatcgtaaagattataatacagaacgctctctggtaatgttggtt
ggtaaaagaagaagtctactagactatttgatgaaaaaggatatcattaggtatcgtgcc
atcgtgaaggaactaggattaagaaaataa

DBGET integrated database retrieval system