KEGG   Gramella forsetii: GFO_0603
Entry
GFO_0603          CDS       T00448                                 

Symbol
rpmI
Name
(GenBank) 50S rbosomal protein L35
  KO
K02916  large subunit ribosomal protein L35
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_0603 (rpmI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_0603 (rpmI)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_0603 (rpmI)
  Bacteria
    GFO_0603 (rpmI)
SSDB
Motif
Pfam: Ribosomal_L35p YfkD
Other DBs
NCBI-ProteinID: CAL65586
UniProt: A0LYZ1
Position
complement(672544..672741)
AA seq 65 aa
MPKMKTKSSAKKRFKLTGTGKIKRKHAFKSHILTKKSKKRKLALTHSTLVHDADKDNVKL
QLRLK
NT seq 198 nt   +upstreamnt  +downstreamnt
atgcctaagatgaaaacgaaatccagtgccaagaagcgttttaagctaacaggtacaggt
aagattaaaagaaagcacgcgtttaagagtcatatcttaacaaagaagtctaagaaacgt
aagcttgccttaactcatagtacattagtacacgatgcagataaggacaatgtcaaactt
caattacgtttaaagtaa

DBGET integrated database retrieval system