KEGG   Gramella forsetii: GFO_1063
Entry
GFO_1063          CDS       T00448                                 

Symbol
rpmE2
Name
(GenBank) 50S ribosomal protein L31 type B
  KO
K02909  large subunit ribosomal protein L31
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_1063 (rpmE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_1063 (rpmE2)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    GFO_1063 (rpmE2)
SSDB
Motif
Pfam: Ribosomal_L31
Other DBs
NCBI-ProteinID: CAL66037
UniProt: A0M092
Position
1136877..1137161
AA seq 94 aa
MHLENKKIKAMKQGIHPENYRLVAFKDMSNEDVFLTKSTAKTKESIEVDGTEYPLVKLEI
SRTSHPYYTGQTKLVDSAGRIDKFKNKYSKFKKK
NT seq 285 nt   +upstreamnt  +downstreamnt
ttgcacctcgaaaataaaaagatcaaagcgatgaagcagggaatccatccggaaaattat
agattagtagcatttaaagatatgtctaatgaagacgtatttcttacaaagtctactgca
aaaacaaaagaaagcattgaagttgacggaactgaatacccgttggtaaaactggagata
tccagaacttctcacccatactacacagggcaaactaagcttgtggatagtgctggtaga
attgataaattcaagaacaaatactcgaaattcaagaaaaagtaa

DBGET integrated database retrieval system