KEGG   Gramella forsetii: GFO_1073
Entry
GFO_1073          CDS       T00448                                 

Symbol
rpmH
Name
(GenBank) 50S ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_1073 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_1073 (rpmH)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_1073 (rpmH)
  Bacteria
    GFO_1073 (rpmH)
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
NCBI-ProteinID: CAL66047
UniProt: A0M0A2
Position
1144516..1144674
AA seq 52 aa
MKRTFQPSKRKRKNKHGFRERMASANGRKVLARRRAKGRKKLSVSSENRHKH
NT seq 159 nt   +upstreamnt  +downstreamnt
atgaaaagaacgtttcaaccatctaagaggaaaagaaaaaataagcacggctttagggag
cgtatggcaagtgcaaacggaagaaaagtccttgctcgaagaagagcaaagggcagaaag
aaattatctgtatcttctgaaaacagacataaacattaa

DBGET integrated database retrieval system