KEGG   Gramella forsetii: GFO_1108
Entry
GFO_1108          CDS       T00448                                 

Symbol
rpsF
Name
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_1108 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_1108 (rpsF)
   03029 Mitochondrial biogenesis [BR:gfo03029]
    GFO_1108 (rpsF)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_1108 (rpsF)
  Bacteria
    GFO_1108 (rpsF)
Mitochondrial biogenesis [BR:gfo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GFO_1108 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6 NAS
Other DBs
NCBI-ProteinID: CAL66082
UniProt: A0M0D7
Position
1178457..1178795
AA seq 112 aa
MNNYETVFILNPVLSDEQIKETVKKYEDFLVSKGAEMVAKEDWGLRKLAYAIQHKKSGFY
HLFEYKAPGDAIEPLELEFRREERMMRYLTVKLDKHAIAWAEKRRKRNKEKA
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaacaattatgaaactgttttcatcttgaatcccgttttatctgatgagcagataaag
gagacagttaagaaatacgaagattttcttgtttctaaaggagctgagatggtagctaaa
gaagattggggcctaagaaaactggcttatgcaatccaacacaagaaaagtggtttttat
cacttatttgaatacaaagctcctggtgatgcaattgagccgctagagttagaattcaga
agagaagagcgtatgatgcgttatttaactgtaaagttagacaagcatgctatcgcctgg
gctgaaaaaagaagaaaacgtaacaaggaaaaagcgtaa

DBGET integrated database retrieval system