KEGG   Gramella forsetii: GFO_1109
Entry
GFO_1109          CDS       T00448                                 

Symbol
rpsR
Name
(GenBank) 30S ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_1109 (rpsR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_1109 (rpsR)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_1109 (rpsR)
  Bacteria
    GFO_1109 (rpsR)
SSDB
Motif
Pfam: Ribosomal_S18
Other DBs
NCBI-ProteinID: CAL66083
UniProt: A0M0D8
Position
1178798..1179097
AA seq 99 aa
MATSIEQQAKGKKDGEIRYLTPLNIETTKAKKYCRFKRSGIKYIDYKDPDFLMGFVNEQG
KLLPRRLTGTSLKFQRKVATAVKRARHLALMPYVGDLLK
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcaacatctattgaacaacaagcaaaaggaaaaaaagacggagagatcaggtatctt
actcctcttaatatagagactaccaaggctaagaaatactgtaggtttaaaagatcgggt
atcaagtatatcgattataaagatccagatttcttaatgggctttgtaaacgaacagggt
aaattgttacctcgtcgtttaacaggtacttctttgaagttccagagaaaagtggctaca
gccgtaaaacgtgctcgtcacttagcattaatgccttacgtaggtgatttattaaaataa

DBGET integrated database retrieval system