KEGG   Gramella forsetii: GFO_1110
Entry
GFO_1110          CDS       T00448                                 

Symbol
rplI
Name
(GenBank) 50S ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_1110 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_1110 (rplI)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_1110 (rplI)
  Bacteria
    GFO_1110 (rplI)
SSDB
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N
Other DBs
NCBI-ProteinID: CAL66084
UniProt: A0M0D9
Position
1179110..1179559
AA seq 149 aa
MEVILKKDVDNLGFKDDLVAVKNGYGRNYLIPHGFAELATPSARKVLSETLKQRAYKEQK
HIDEAKKQAEKLNNLEIKITAKAGAGDKLFGSITNGDLADALAKEGVEIEKKYISIAGGN
IKRLGQYDATLRFHREVISNFSFDVVGDA
NT seq 450 nt   +upstreamnt  +downstreamnt
atggaagtgatacttaaaaaagacgtagataatttaggttttaaagatgatcttgtagct
gttaagaacggttacggtagaaactatcttattccacatggttttgctgaattagcaact
ccttctgcaagaaaagttttatctgaaactttgaagcagagagcctataaagaacaaaag
catattgacgaagctaaaaaacaagctgaaaagcttaataacctggaaattaagattact
gctaaggcaggtgcaggggataagctttttggatccattactaatggagatttagctgat
gctcttgctaaagaaggtgtagagatcgaaaagaaatatattagcattgctggtggaaac
atcaaacgtttaggacagtatgatgctactttacgttttcatcgtgaagtaatatctaac
ttttcttttgacgttgtaggagacgcttaa

DBGET integrated database retrieval system