KEGG   Gramella forsetii: GFO_1849
Entry
GFO_1849          CDS       T00448                                 

Symbol
rpsA
Name
(GenBank) 30S ribosomal protein S1
  KO
K02945  small subunit ribosomal protein S1
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_1849 (rpsA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_1849 (rpsA)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    GFO_1849 (rpsA)
SSDB
Motif
Pfam: S1 PCB_OB Sec2p
Other DBs
NCBI-ProteinID: CAL66819
UniProt: A0M2H4
Position
complement(1947140..1949002)
AA seq 620 aa
MAEETKNKEVQDNTENVEVQDVAGMDSQSQPEQEKQQENPEKFLKEFNWHNYEEGIDPID
DKKLEEFEKLVAANFVDTLDDEVVTGKVINITDRDAIIDINAKSEGVISLNEFRYNPDLK
EGDDVEVLIDVREDSTGQLILSHRKARVIKAWERVNTAHDESLVVNGFIKCRTKGGMIVD
VFGIEAFLPGSQIDVKPIRDYDAYVGKNMEFKVVKINHEFKNVVVSHKALIEADIEEQKK
EIIGQLEKGQVLEGTVKNITSYGVFVDLGGVDGLVHITDLSWSRINHPNEIVELDQKLNV
VILDFDESKSRIQLGLKQLSQHPWDALNEQLKVGDNVKGKVVVIADYGAFIEVAEGVEGL
IHVSEMSWSTHLRSAQDFVNVGDEVEAQILTLDREDRKMSLGIKQLSQDPWTDITSKYPV
GSKHEGIVRNFTNFGVFVELEEGIDGLIYISDLSWTKKIKHPSEFTNVGDKLEVVVLELD
VEGRKLSLGHKQIEDNPWDKYEKDFGVGSKHTAAITEIVDKGATIDFNEDITAFIPQRHL
EKEDGSKLKQGEGAEFQIIEFNKEFKRVVASHMVIHKEEEQKIVKQAAKKSASQGKDSAT
TIGDVNADLQALKDKMEGKK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggctgaagaaacaaaaaacaaagaagttcaggacaacactgaaaatgttgaggttcag
gacgtagcaggtatggattctcaatctcaacctgaacaagaaaaacaacaggaaaatcct
gagaaattccttaaagaattcaactggcacaactacgaagaaggaattgatcctatcgac
gataagaagctggaagaatttgaaaaactggtagcagcaaatttcgtagacactttagat
gacgaagttgtaacaggaaaagtaattaatattacagatcgtgatgcaattatcgatatc
aacgcaaaaagtgaaggtgtaatttctcttaacgagtttcgttacaatccagaccttaaa
gaaggtgatgacgttgaagtactcattgacgttcgtgaagattcgacaggtcagttgatc
ctttctcaccgtaaggcgagagtgatcaaggcttgggaaagagtaaacacagcacacgat
gaaagtcttgtagtaaacgggtttattaaatgccgtactaagggtggtatgatcgtggac
gtatttggtattgaagctttcttacctggttcacaaattgatgtgaagccaattagagac
tacgatgcttatgtaggaaagaacatggaattcaaagtggttaaaattaaccatgaattc
aaaaacgttgtggtttctcacaaagcgcttatcgaagcagatatcgaagagcagaagaaa
gagatcatcggtcagcttgaaaaaggtcaggtacttgaaggtactgttaagaatatcact
tcttacggtgtattcgttgatcttggaggtgttgatggacttgtacatattacagatctt
tcttggtctagaatcaaccatccaaatgagatcgttgagcttgatcagaaattgaatgtt
gtaatccttgattttgatgaatctaaatcaagaattcagttaggtcttaagcaacttagc
caacacccatgggatgcacttaatgagcaacttaaagttggtgacaatgtaaaaggtaaa
gtagttgtaatcgcagattacggtgcatttattgaggttgctgaaggtgttgaaggtctt
atccacgtttctgaaatgtcttggagtacgcacttgcgttcagctcaggatttcgtaaat
gttggtgatgaggtagaagcacaaattcttactttagatagagaagacagaaaaatgtct
cttggtatcaagcaattgagccaggatccatggactgatattacttctaagtatcctgta
ggttctaagcatgaaggtatcgttcgtaactttactaacttcggagtattcgttgagtta
gaagaaggaatcgacggacttatttatatctctgatctttcatggactaagaaaatcaag
catccatctgaatttacgaatgtaggtgataagcttgaagtagtagttcttgagcttgat
gttgaaggtagaaaacttagtcttggacataagcagatcgaggacaatccttgggataag
tatgaaaaagactttggagttggatctaagcatactgcagcgatcactgagatcgtagac
aaaggtgctactatagacttcaatgaagatatcacggcatttattccgcaaagacatctt
gaaaaagaagacggaagtaaactgaagcagggtgaaggagcagaattccaaattattgaa
ttcaacaaagaattcaagagagtggtagcttctcacatggtaattcacaaagaagaagag
caaaaaattgttaagcaggctgctaagaaatcagcttcacaaggcaaagatagcgccact
actattggtgatgttaatgctgatcttcaagcgttgaaagataaaatggaaggtaagaaa
taa

DBGET integrated database retrieval system