KEGG   Gramella forsetii: GFO_2243
Entry
GFO_2243          CDS       T00448                                 

Symbol
rpmG
Name
(GenBank) 50S ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2243 (rpmG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2243 (rpmG)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2243 (rpmG)
  Bacteria
    GFO_2243 (rpmG)
SSDB
Motif
Pfam: Ribosomal_L33
Other DBs
NCBI-ProteinID: CAL67208
UniProt: A0M3L3
Position
complement(2388274..2388456)
AA seq 60 aa
MAKKGNRVQVILECTEHKTSGQPGTSRYITTKNKKNTPDRIELKKFNPILKKMTVHKEIK
NT seq 183 nt   +upstreamnt  +downstreamnt
atggcaaagaaaggtaacagagttcaggtaattctagaatgtacagagcataagacatct
gggcaaccaggtacttcaagatatattactacaaaaaataagaagaatacaccggataga
atcgagttgaagaaattcaacccaattcttaagaaaatgacggttcataaagaaattaaa
taa

DBGET integrated database retrieval system