KEGG   Gramella forsetii: GFO_2244
Entry
GFO_2244          CDS       T00448                                 

Symbol
rpmB
Name
(GenBank) 50S ribosomal protein L28
  KO
K02902  large subunit ribosomal protein L28
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2244 (rpmB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2244 (rpmB)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2244 (rpmB)
  Bacteria
    GFO_2244 (rpmB)
SSDB
Motif
Pfam: Ribosomal_L28 RWP-RK
Other DBs
NCBI-ProteinID: CAL67209
UniProt: A0M3L4
Position
complement(2388483..2388722)
AA seq 79 aa
MSRVCELTGKRAMVGNNVSHAMNKTKRKFNANLVKKRFFLPEEDRWVTLKVCTSALKDIN
KKGISAVIKEAKAKGFLQK
NT seq 240 nt   +upstreamnt  +downstreamnt
atgtcaagagtttgtgaacttaccgggaaaagagcaatggttgggaataatgtttctcac
gccatgaataagactaaacgtaaatttaacgccaacttagttaaaaaacgtttctttctt
cctgaagaagacagatgggtaacacttaaggtgtgtacgtctgcattaaaagatatcaat
aaaaaaggcatttctgccgtaattaaggaagctaaagcaaaaggatttcttcagaaataa

DBGET integrated database retrieval system