KEGG   Gramella forsetii: GFO_2371
Entry
GFO_2371          CDS       T00448                                 

Symbol
rplL
Name
(GenBank) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2371 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2371 (rplL)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2371 (rplL)
  Bacteria
    GFO_2371 (rplL)
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Hydantoinase_A DUF2125 PqqD
Other DBs
NCBI-ProteinID: CAL67335
UniProt: A0M3Z0
Position
complement(2523586..2523960)
AA seq 124 aa
MADLKDFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGGAAGGEEAEEQTEFDV
ILTAPGGSKLAVVKLVKELTGLGLKDAKALVDEAPKPVKEGVAKDEAEALKAQLEEAGAE
VELK
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcagatttaaaagatttcgcagaacaattagttaatcttactgtaaaagaagtaaac
gaattagctgatattttaaaagaagaatatggtattgagcctgctgctgctgcagtagct
gttgctggtggtggtgccgctggtggtgaagaagctgaagagcaaacagaattcgacgta
attcttactgctccaggtggatctaaattggcagtagttaagttggtaaaagaacttaca
ggtcttggtcttaaagatgcaaaagcattagtagacgaagctccaaaaccagttaaagaa
ggagttgcaaaagacgaagctgaagcattaaaagcacagttagaagaagcaggagctgag
gttgagcttaaataa

DBGET integrated database retrieval system