KEGG   Gramella forsetii: GFO_2374
Entry
GFO_2374          CDS       T00448                                 

Symbol
rplK
Name
(GenBank) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2374 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2374 (rplK)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2374 (rplK)
  Bacteria
    GFO_2374 (rplK)
  Archaea
    GFO_2374 (rplK)
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-ProteinID: CAL67338
UniProt: A0M3Z3
Position
complement(2525267..2525704)
AA seq 145 aa
MAKEVSKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNGRTQDKQGKVLPVAITV
YKDKSFDFVIKTPPAAVQLMEAAKTKKGSGEPNRKKVASVSWDQVKAIAEDKMQDLNAFT
VESAMKMVAGTARSMGITVKGDAPF
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcaaaagaagtaagtaaagttgtaaaactacaagttcgcggaggtgctgctaaccca
tcaccaccagttggacctgctttaggtgctgccggggtaaatatcatggaattctgtaag
caattcaatggtagaactcaggataagcaaggaaaggtgcttccagttgcaattactgta
tataaggataagtcttttgattttgtgatcaagactccacctgcagcagtacaattgatg
gaagcggctaagactaaaaaaggttctggtgagccgaacagaaaaaaagtggctagtgtt
tcttgggatcaggttaaagcgattgcagaagacaagatgcaggatcttaatgcatttact
gtagagtctgcaatgaaaatggttgccggaacagctcgttcgatgggaataactgtaaaa
ggtgatgcaccgttttaa

DBGET integrated database retrieval system