KEGG   Gramella forsetii: GFO_2387
Entry
GFO_2387          CDS       T00448                                 

Symbol
rpsU
Name
(GenBank) 30S ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2387 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2387 (rpsU)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_2387 (rpsU)
  Bacteria
    GFO_2387 (rpsU)
SSDB
Motif
Pfam: Ribosomal_S21
Other DBs
NCBI-ProteinID: CAL67346
UniProt: A0M401
Position
complement(2530378..2530620)
AA seq 80 aa
MHYLCNRFQKKGGDDTMLIIPVKDGENIDRALKRFKRKFDKTGTMRQLRDRQHFTKPSVE
RRAQVQKAEYIQHLRDAEDI
NT seq 243 nt   +upstreamnt  +downstreamnt
atgcattatctttgcaaccgattccaaaagaagggaggtgatgacactatgttaattata
ccagttaaagacggagaaaatatagatagagctcttaagcgttttaagcgtaagttcgac
aaaaccggaactatgcgtcagctaagagatcgtcagcattttacaaaaccttctgtagag
cgtagagctcaggttcagaaagctgaatacatccagcatctgagagacgcagaagatatc
tag

DBGET integrated database retrieval system