KEGG   Gramella forsetii: GFO_2731
Entry
GFO_2731          CDS       T00448                                 

Symbol
rpsT
Name
(GenBank) 30S ribosomal protein S20
  KO
K02968  small subunit ribosomal protein S20
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2731 (rpsT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2731 (rpsT)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    GFO_2731 (rpsT)
SSDB
Motif
Pfam: Ribosomal_S20p Uds1
Other DBs
NCBI-ProteinID: CAL67687
UniProt: A0M4Z2
Position
complement(2846116..2846364)
AA seq 82 aa
MANHKSALKRIRSNETKRLRNRYQHKTTRNAIKKLRDADKKEAEGMLPSVISMVDKLAKK
NIIHDNKAANLKSQLTKHVAAL
NT seq 249 nt   +upstreamnt  +downstreamnt
atggcaaatcataagtcagcgttgaagaggattcgtagcaatgagactaaacgtctaaga
aatcgctaccagcataaaactacaagaaacgcgattaaaaaattgcgtgatgccgataag
aaagaggctgaaggaatgttgccttctgtaatttctatggtagacaaattggctaagaaa
aatattattcacgataataaagctgctaacctaaagtcacaattgactaagcacgtcgca
gcactttaa

DBGET integrated database retrieval system