KEGG   Gramella forsetii: GFO_2813
Entry
GFO_2813          CDS       T00448                                 

Symbol
rplQ
Name
(GenBank) 50S ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2813 (rplQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2813 (rplQ)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2813 (rplQ)
  Bacteria
    GFO_2813 (rplQ)
SSDB
Motif
Pfam: Ribosomal_L17 RR_TM4-6 AIF_C FGF-BP1
Other DBs
NCBI-ProteinID: CAL67767
UniProt: A0M572
Position
complement(2930038..2930583)
AA seq 181 aa
MRHGKKINHLGRQTAHRKAMLANMACSLIEHKRINTTVAKAKALKVFVEPLVTKCKNDTT
HNRRLVFSKLRSKEAVSELFREVAPKVGDRPGGYTRVIKLGSRLGDAAEMALVELVDFNE
TYNVGEKPKKKKSTRRAGKKKTEDTASTAEPKEASAKETKKEEPKAKEPKAEEKKDDKKE
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagacacggaaagaaaataaaccacttaggtagacaaactgcacatcgtaaagctatg
cttgcgaatatggcatgttccctaattgagcataaacgtatcaatacaacggtagctaaa
gctaaagctcttaaagtatttgtagagcctctagttactaaatgtaagaacgatactact
cacaacagacgtcttgtgtttagtaagcttagaagtaaagaagctgtaagcgaattattt
cgtgaagtagctcctaaagtaggagatcgcccgggaggttataccagagttatcaaactt
ggtagtcgtcttggggatgctgcagaaatggcattggtagaacttgtagactttaatgaa
acctacaatgtaggagagaagcctaagaagaaaaaatctactcgtcgtgctggtaagaag
aagactgaagatacagcttctactgccgagcctaaagaagcttctgctaaagaaacgaaa
aaagaagagcctaaagctaaagagccaaaggctgaagaaaaaaaggacgataaaaaagag
gaataa

DBGET integrated database retrieval system