KEGG   Gramella forsetii: GFO_2816
Entry
GFO_2816          CDS       T00448                                 

Symbol
rpsK
Name
(GenBank) 30S ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2816 (rpsK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2816 (rpsK)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_2816 (rpsK)
  Bacteria
    GFO_2816 (rpsK)
  Archaea
    GFO_2816 (rpsK)
SSDB
Motif
Pfam: Ribosomal_S11
Other DBs
NCBI-ProteinID: CAL67770
UniProt: A0M575
Position
complement(2932384..2932785)
AA seq 133 aa
MAKKANPKAKTQKKRKVVVESNGEAHVTASFNNIIISLTNKKGDVVAWSSAGKMGFRGSK
KNTPYAAQLAAEDASKVAHEAGMRKVKVYVKGPGNGRESAIRAVHNSGIEVTEIIDITPL
PHNGCRPPKRRRV
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcaaagaaagcaaatccaaaagctaaaactcagaaaaaacgtaaagtagtcgttgaa
tccaacggtgaagcacacgtaactgcttcttttaacaacattattatttctcttaccaac
aaaaagggagatgttgttgcatggtcgtctgcaggtaagatgggctttagaggatctaag
aaaaatactccttacgctgcacaattagctgctgaagatgcttcgaaagtagcacatgag
gcaggtatgcgtaaagtgaaggtttatgtaaaaggtcctggaaacggtagagaatctgca
ataagagcagttcacaatagtggtatcgaagttactgaaattatcgatattactccactt
ccacacaacggttgtcgtccaccaaagagacgtagagtttaa

DBGET integrated database retrieval system