KEGG   Gramella forsetii: GFO_2820
Entry
GFO_2820          CDS       T00448                                 

Symbol
rplO
Name
(GenBank) 50S ribosomal protein L15
  KO
K02876  large subunit ribosomal protein L15
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2820 (rplO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2820 (rplO)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2820 (rplO)
  Bacteria
    GFO_2820 (rplO)
  Archaea
    GFO_2820 (rplO)
SSDB
Motif
Pfam: Ribosomal_L27A Ribosomal_L18 TFIIA_gamma_N
Other DBs
NCBI-ProteinID: CAL67774
UniProt: A0M579
Position
complement(2934972..2935424)
AA seq 150 aa
MDLSNLKPAEGSVRKNSKRIGRGEGSGKGGTATRGHKGAKSRSGYSKKIGFEGGQMPLQR
RVPKFGFTNRNRKVYQGINLDTLQNLVDEGRIKDTVDMDVLVENGLAGRNELVKILGRGE
LKAKLKISVHKFTASAKEAIEAAGGEVVTL
NT seq 453 nt   +upstreamnt  +downstreamnt
atggatttaagtaacttaaaacctgcagaaggttcagttagaaagaatagcaagcgtatt
ggtcgtggtgaaggatctggtaaaggtggaaccgctaccagaggtcacaaaggtgccaag
tcacgttcaggttattctaaaaagattggttttgaaggtgggcagatgccacttcagaga
cgtgttccaaaatttggattcactaacagaaaccgtaaagtatatcagggaattaacctg
gatacattacagaacctggtagatgaaggaagaattaaggatacagttgatatggacgtg
ttggttgaaaacggtcttgccggaagaaacgagcttgttaagatattaggtagaggtgaa
ttaaaggctaagttgaaaatatctgttcataaatttacggcctcagcgaaagaagctatt
gaagctgccggaggtgaagttgttactttataa

DBGET integrated database retrieval system