KEGG   Gramella forsetii: GFO_2822
Entry
GFO_2822          CDS       T00448                                 

Symbol
rpsE
Name
(GenBank) 30S ribosomal protein S5
  KO
K02988  small subunit ribosomal protein S5
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2822 (rpsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2822 (rpsE)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_2822 (rpsE)
  Bacteria
    GFO_2822 (rpsE)
  Archaea
    GFO_2822 (rpsE)
SSDB
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5
Other DBs
NCBI-ProteinID: CAL67776
UniProt: A0M581
Position
complement(2935630..2936154)
AA seq 174 aa
MYQDYKNVEHVKPGGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKS
KEVADAISKAVEDAKKNLVRIPLHKGTLPHEQKGKYGGARVMLLPAAAGTGIIAGGAIRA
VLESVGVHDVLSKNQGSSNPHNVVKATFDALLQLRSAETVAKQRGVSLEKVFKG
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtatcaagattataaaaacgtagaacatgtaaaaccaggaggtcttgaattaaaggat
cgtttggttggagtacaacgtgttactaaggttacaaaaggtggtagagcatttggattc
tctgctattgttgtagttggagatgaaaatggtgttgttggacaaggacttggaaaatcc
aaggaagttgcagacgctatttctaaagcggtagaagatgctaagaaaaatctggtacgc
atccctttacacaaaggaactttaccgcacgaacaaaaaggtaagtatggtggagcaaga
gtaatgcttcttccagctgctgccggtaccggtattattgctggtggtgcgattcgtgca
gtattggaatctgttggggtacatgatgtactttctaagaaccagggatcttcaaaccct
cacaatgttgtaaaagctacttttgatgccttactacaattaagaagtgctgaaactgtt
gcgaaacagagaggcgtttcattggaaaaggtttttaaaggataa

DBGET integrated database retrieval system