KEGG   Gramella forsetii: GFO_2824
Entry
GFO_2824          CDS       T00448                                 

Symbol
rplF
Name
(GenBank) 50S ribosomal protein L6
  KO
K02933  large subunit ribosomal protein L6
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2824 (rplF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2824 (rplF)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2824 (rplF)
  Bacteria
    GFO_2824 (rplF)
  Archaea
    GFO_2824 (rplF)
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-ProteinID: CAL67778
UniProt: A0M583
Position
complement(2936529..2937071)
AA seq 180 aa
MSRIGKSPVTIPEGVTVDHKDGVVTVKGKLGELKQEIRDIDVKIEDNVITFERSSEKSDQ
KAKHGLYRALVNNMIEGVTNGYTKSLELVGVGYRATNQGNKLDLAVGYSHNIVLDLAPEV
KVETISEKGKNPIVKVTSHDKQLVGQVAAKIRSFRAPEPYKGKGIKFVGEQLRRKAGKSA
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtcaagaataggtaaaagcccagttacaattccagaaggtgtgacagtagatcacaaa
gatggtgttgtaacggtaaaaggaaagttaggagagcttaagcaagagataagagatatc
gatgttaaaatcgaagataatgttattacttttgagcgttcttcagaaaaaagtgatcag
aaagctaaacatggtttgtaccgtgctttggtaaacaatatgattgaaggggttacaaac
ggttacactaaatcacttgaattggtaggtgtaggttaccgtgctacgaaccaggggaac
aagttagatcttgctgttggttattcccataatattgtgctagatttggctcccgaagtt
aaggtggagactatctcagaaaaaggtaagaacccgatcgtaaaggtaacttctcatgat
aaacaacttgttggacaggttgcagctaaaatccgttcattcagagcaccagaaccatat
aaaggtaaaggtatcaagtttgttggagagcaattgagaagaaaagcaggtaaatcagct
taa

DBGET integrated database retrieval system