KEGG   Gramella forsetii: GFO_2825
Entry
GFO_2825          CDS       T00448                                 

Symbol
rpsH
Name
(GenBank) 30S ribosomal protein S8
  KO
K02994  small subunit ribosomal protein S8
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2825 (rpsH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2825 (rpsH)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    GFO_2825 (rpsH)
  Archaea
    GFO_2825 (rpsH)
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-ProteinID: CAL67779
UniProt: A0M584
Position
complement(2937091..2937489)
AA seq 132 aa
MNTDPIADYLTRIRNANAANHRVVEIPASNVKKEITKILFDQGYILSYKFEDTTAQGTIK
IALKYDKLTKEPVIKKIQRISKPGLRKYAGSTEIPRILNGLGIAVVSTSHGVMTGKQAKA
NKVGGEVLCYVY
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaatacagatcctattgcagattacttaacaagaatcaggaatgcaaatgctgcgaac
cacagagtagtggaaattcctgcttccaatgttaaaaaagagatcacaaagatattattc
gatcagggatatattcttagttataaattcgaagatactaccgctcagggaactatcaag
atcgctcttaagtacgataaacttactaaagagccggtaattaagaagatccagagaata
agtaaacctggtttacgtaaatacgctggatcaactgaaattccaagaatccttaatggt
cttggtattgcggttgtttctacttctcacggagtaatgactggaaaacaagcgaaagcg
aataaagttggtggcgaggtattgtgctacgtatactaa

DBGET integrated database retrieval system