KEGG   Gramella forsetii: GFO_2827
Entry
GFO_2827          CDS       T00448                                 

Symbol
rplE
Name
(GenBank) 50S ribosomal protein L5
  KO
K02931  large subunit ribosomal protein L5
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2827 (rplE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2827 (rplE)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2827 (rplE)
  Bacteria
    GFO_2827 (rplE)
  Archaea
    GFO_2827 (rplE)
SSDB
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5
Other DBs
NCBI-ProteinID: CAL67781
UniProt: A0M586
Position
complement(2937832..2938383)
AA seq 183 aa
MAYVPRLRQEYNERVKSALKEEFSYSNIMEVPKLTKIVISRGVGGAVADKKLIDHAIDEL
SAISGQKAVSTISKKDVASFKLRKGMPIGAKVTLRGYRMYEFLDRLITSALPRVRDFNGI
KSNGFDGRGNYNLGVTEQIIFPEIDIDAVNRIAGMDITFVTTADTDKEAKALLTELGLPF
KKN
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcatacgtaccaagacttagacaggaatataacgagagagtgaaaagtgctcttaag
gaagaattcagctactccaatataatggaggtgccaaaacttacgaaaatagtaattagc
cgtggagttggtggagcagtggcagataagaaacttatcgaccatgctatcgacgaactt
tcagctattagcggtcaaaaggccgtttctactatttcgaaaaaggatgttgcatcgttt
aagctgcgtaagggaatgccaattggagcaaaagttactttacgcggatatagaatgtat
gaattcttagatagattaatcactagtgcgttaccacgtgtacgtgattttaacggaatc
aaatctaatggatttgatggtagaggtaactataaccttggggtgacagagcaaatcatc
ttccctgagatagatattgatgcagtgaatagaatcgctggtatggatatcacatttgtt
accactgctgataccgataaggaagcaaaagcattgttaacagaactaggattacctttt
aaaaagaactaa

DBGET integrated database retrieval system