KEGG   Gramella forsetii: GFO_2828
Entry
GFO_2828          CDS       T00448                                 

Symbol
rplX
Name
(GenBank) 50S ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2828 (rplX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2828 (rplX)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2828 (rplX)
  Bacteria
    GFO_2828 (rplX)
  Archaea
    GFO_2828 (rplX)
SSDB
Motif
Pfam: ribosomal_L24 KOW GTP_EFTU_D2
Other DBs
NCBI-ProteinID: CAL67782
UniProt: A0M587
Position
complement(2938386..2938697)
AA seq 103 aa
MTKLKIKSGDTVRVIAGDHKGQEGKVQKVLIEKNKAIVEGVNMISKHEKPSASNPQGGIK
EKEAPIHISNLSLIDKNGDTTRVGYKEEDGKKVRFSKKSNEVI
NT seq 312 nt   +upstreamnt  +downstreamnt
atgacaaagcttaagataaaatcaggagataccgttcgtgtaattgctggagaccataaa
ggtcaggaaggtaaagtgcagaaggtacttattgaaaagaacaaagccattgtggaaggg
gttaatatgatctctaaacatgagaagccaagtgcttctaatccacaaggtggtattaag
gagaaagaagctcctatccatatttctaatctttcactaatcgataagaatggtgataca
accagagttggttataaagaagaagatggaaagaaagtgagattttctaaaaaatctaat
gaagtaatatag

DBGET integrated database retrieval system