KEGG   Gramella forsetii: GFO_2829
Entry
GFO_2829          CDS       T00448                                 

Symbol
rplN
Name
(GenBank) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2829 (rplN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2829 (rplN)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2829 (rplN)
  Bacteria
    GFO_2829 (rplN)
  Archaea
    GFO_2829 (rplN)
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-ProteinID: CAL67783
UniProt: A0M588
Position
complement(2938710..2939078)
AA seq 122 aa
MVQQESRLKVADNTGAKEVLAIRVLGGTKKRYASVGDKIVVSVKEATPNGSIKKGAVSTA
VVVRTRKEVRRPDGSYIRFDDNACVLLGPQGEMRGTRVFGPVARELRDKQFMKIVSLAPE
VL
NT seq 369 nt   +upstreamnt  +downstreamnt
atggtacaacaagagtccagactaaaagtagcagataataccggggctaaagaagtttta
gcaatccgtgtattaggaggtacaaagaaaagatacgcatctgttggagacaagatagtt
gtcagtgtaaaagaagctacccctaacggaagtatcaagaagggtgcagtttcaacagca
gttgttgttcgtaccaggaaagaagttcgcagaccagacggatcttatattcgttttgat
gataatgcatgtgtattgttaggtcctcagggagaaatgcgcggaacccgtgtttttggt
cctgtagctcgtgagcttcgtgataagcaattcatgaaaattgtatcattggcaccagaa
gtgctttaa

DBGET integrated database retrieval system