KEGG   Gramella forsetii: GFO_2831
Entry
GFO_2831          CDS       T00448                                 

Symbol
rpmC
Name
(GenBank) 50S ribosomal protein L29
  KO
K02904  large subunit ribosomal protein L29
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2831 (rpmC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2831 (rpmC)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    GFO_2831 (rpmC)
  Archaea
    GFO_2831 (rpmC)
SSDB
Motif
Pfam: Ribosomal_L29
Other DBs
NCBI-ProteinID: CAL67785
UniProt: A0M590
Position
complement(2939357..2939548)
AA seq 63 aa
MKQSEVKELSVAELQEELGKSRKAYSDLKMAHAVSPLENPIQLRTVRRDVARLATELTKR
EQQ
NT seq 192 nt   +upstreamnt  +downstreamnt
atgaaacaatcagaagtaaaagaattgtctgttgcagaattgcaagaagagcttggtaag
tctagaaaagcttattcagatttgaaaatggctcacgctgtttcgcctttggaaaatcca
atacagttaagaactgtaagaagagatgtggcgagattagctacagagttaactaaaaga
gaacaacaataa

DBGET integrated database retrieval system