KEGG   Gramella forsetii: GFO_2833
Entry
GFO_2833          CDS       T00448                                 

Symbol
rpsC
Name
(GenBank) 30S ribosomal protein S3
  KO
K02982  small subunit ribosomal protein S3
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2833 (rpsC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2833 (rpsC)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    GFO_2833 (rpsC)
  Archaea
    GFO_2833 (rpsC)
SSDB
Motif
Pfam: Ribosomal_S3_C KH_2 VAR1 KH_4 MRP-S24
Other DBs
NCBI-ProteinID: CAL67787
UniProt: A0M592
Position
complement(2939999..2940718)
AA seq 239 aa
MGQKTNPIGNRLGIIRGWESNWYGGNDYGDKLAEDDKIRKYIHARLSKASVSRVIIERTL
KLVTVTITTARPGIIIGKGGQEVDKLKEELKKITDKEVQINIFEIKRPELDAHLVGASVA
RQIENRISYRRAIKMAIAAAMRMNAEGIKIEISGRLNGAEMARSESYKDGRIPLSTFRAD
IDYALVEAHTTYGRLGVKVWIMKGEVYGKRELSPLVGLAKNQGKKSGAGRGGNKSRRRK
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggacaaaaaacaaatccaatcgggaatcgccttggtatcattagaggttgggaatcc
aactggtacggaggtaatgattacggcgataagttagccgaagacgataagattagaaag
tatatccatgctcgtctttctaaagcgagtgtatcgcgtgtaatcatcgagcgcacgctt
aagcttgtaaccgttactatcactactgctagacctggtattattatcgggaaaggtggt
caggaggtagacaagcttaaggaagagctaaaaaagattaccgacaaggaagttcaaata
aacatctttgagattaagaggccagaacttgatgctcaccttgtgggtgcgagtgttgcc
agacaaattgagaatcgtatctcttaccgtcgtgcaattaaaatggctatcgcggctgca
atgagaatgaatgctgaaggaatcaaaatagagatttccggacgtttaaatggtgctgaa
atggcacgttcagaatcatacaaagatggaagaattccattgtctacttttagggctgat
attgactatgctttagttgaagcacacactacttatggtagattgggtgttaaagtatgg
atcatgaaaggtgaggtatacggaaaaagagagctttcgcctcttgttggccttgcgaaa
aatcaaggtaagaagtccggagccggacgaggtggtaacaaatcacgtcgtagaaagtaa

DBGET integrated database retrieval system