KEGG   Gramella forsetii: GFO_2834
Entry
GFO_2834          CDS       T00448                                 

Symbol
rplV
Name
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2834 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2834 (rplV)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2834 (rplV)
  Bacteria
    GFO_2834 (rplV)
  Archaea
    GFO_2834 (rplV)
SSDB
Motif
Pfam: Ribosomal_L22 PG_binding_2 DUF1967
Other DBs
NCBI-ProteinID: CAL67788
UniProt: A0M593
Position
complement(2940727..2941134)
AA seq 135 aa
MGVRKRERAEQIKEAKKQVAFAKLNNCPTSPRKMRLMADLVRGEKVEKALHILKFSKKEA
SNRLEKLLVSAIANWQAKNEDANLEEAELFVKEIRVDGGSMLKRLRPAPQGRAHRIRKRS
NHVTLVLGANNNTQS
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggagttcgtaaaagagaaagagcagagcaaataaaagaagccaagaaacaggtagct
tttgcaaagttaaataactgccctacttcacctagaaaaatgcgtcttatggcggattta
gtaagaggtgaaaaagtagaaaaagcgcttcatattttaaaattcagcaagaaagaagct
tcaaatcgcttagagaaactattggtttcagcaattgccaactggcaagctaagaatgag
gatgcaaatcttgaagaagctgaattatttgtgaaagagattcgtgtagacggaggaagt
atgttaaaaagacttcgtccagctccacagggtcgtgcacaccgaattagaaagagatcc
aaccacgttacattggtgcttggagcaaacaataatacacaaagctaa

DBGET integrated database retrieval system