KEGG   Gramella forsetii: GFO_2835
Entry
GFO_2835          CDS       T00448                                 

Symbol
rpsS
Name
(GenBank) 30S ribosomal protein S19
  KO
K02965  small subunit ribosomal protein S19
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2835 (rpsS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2835 (rpsS)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    GFO_2835 (rpsS)
  Archaea
    GFO_2835 (rpsS)
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-ProteinID: CAL67789
UniProt: A0M594
Position
complement(2941140..2941418)
AA seq 92 aa
MARSLKKGPFVHYKLEQKVAQNVESGKKAVIKTWSRASMITPDFVGQTIAVHNGKQFVPV
YVTENMVGHKLGEFSPTRSFRGHAGAKNKGRK
NT seq 279 nt   +upstreamnt  +downstreamnt
atggcacgttcattaaaaaaaggacctttcgttcattacaaactggaacaaaaagtggct
cagaatgttgagtcaggaaagaaagccgtgatcaaaacctggtctagagcttctatgatt
actccagactttgtagggcaaactattgcagtacacaacgggaaacaatttgttcctgtt
tatgtaactgaaaacatggtaggtcataaactaggagaattttcaccaacgcgttctttc
agaggacatgcaggtgcaaaaaataaaggtagaaaatag

DBGET integrated database retrieval system