KEGG   Gramella forsetii: GFO_2836
Entry
GFO_2836          CDS       T00448                                 

Symbol
rplB
Name
(GenBank) 50S ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2836 (rplB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2836 (rplB)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2836 (rplB)
  Bacteria
    GFO_2836 (rplB)
  Archaea
    GFO_2836 (rplB)
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-ProteinID: CAL67790
UniProt: A0M595
Position
complement(2941422..2942261)
AA seq 279 aa
MSVRKLKPITPGQRFRVVNGYDAITTDKPEKSLLAPIKKSGGRNSQGKMTMRYKGGGHKK
RYRVIDFKRDKQGIPATVASIEYDPNRTAFIALLNYQDGEKRYIIAQNGLQVDQNVVSSN
EAATPEIGNAMPLANIPLGTVISCIELRPGQGAVMARSAGAFAQLLAREGKYATIKLPSG
EIRRVLALCMATIGAVSNSDHQLMIGGKAGRSRWLGIRPRTRPVAMNPVDHPMGGGEGRA
SGGHPRSRKGLPAKGFKTRSRTKASNKYIVERRKTRKKK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcagttagaaaattaaaaccaattacacctggtcagcgttttagagtagttaatggg
tatgacgccattactactgataagccggagaaaagcctattggcgccgataaaaaaatca
ggtggtagaaacagtcaaggtaagatgaccatgcgctataagggtggtggtcataagaaa
cgttaccgagttatcgattttaaacgtgacaagcagggaattcctgcaactgtcgctagt
atagaatacgatccaaacagaacggcttttatcgcattattgaattatcaagatggtgag
aaaaggtatattattgctcaaaacgggcttcaggtagatcaaaatgtagtttctagtaat
gaagctgcaactcctgaaattggaaatgcgatgcctttggctaacattccgcttggtact
gtgatctcttgtatagagctaagacctggacaaggtgctgtaatggcgcgtagtgctggt
gcttttgctcaattattggcaagagaaggaaagtatgctactatcaaattgccttcaggt
gagattcgtagagttcttgctttatgtatggcgactataggagctgtttctaacagtgat
catcagcttatgatcggtggtaaagccggtagaagcagatggttgggtatccgtccaaga
acaagaccagtagctatgaaccctgtagatcacccaatgggtggtggtgaaggtagagct
tctggaggtcacccacgttcaagaaaaggtcttcctgctaaaggatttaagacccgttca
agaacgaaagcgagtaataaatatattgtagaacgtagaaagactagaaagaaaaaataa

DBGET integrated database retrieval system