KEGG   Gramella forsetii: GFO_2838
Entry
GFO_2838          CDS       T00448                                 

Symbol
rplD
Name
(GenBank) 50S ribosomal protein L4
  KO
K02926  large subunit ribosomal protein L4
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2838 (rplD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2838 (rplD)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_2838 (rplD)
  Bacteria
    GFO_2838 (rplD)
SSDB
Motif
Pfam: Ribosomal_L4
Other DBs
NCBI-ProteinID: CAL67792
UniProt: A0M597
Position
complement(2942571..2943197)
AA seq 208 aa
MEIAVLDIKGKETGRKAKLSDSVFAIEPNDHAVYLDVKQYLANQRQGTHKAKERAEIKGS
TRKIKKQKGTGTARAGSIKSPIFKGGGRVFGPRPRNYGFKLNKNLKRLARKSALSIKAND
KAIMVIEDFSFDTPKTKNFTEVLKALGIESKKSLIVLGDSNKNVYLSSRNLKTSEVISSS
ELSTYKILNAKSIVFLEGSLEGIESKLS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggaaatagcagttttagatataaaaggaaaagaaacgggcagaaaagcaaagctttct
gattctgttttcgctatagagcctaatgaccacgctgtttatcttgatgttaaacaatac
ctggctaaccagcgtcagggaactcataaagctaaagaaagagcagagatcaagggttct
actcgtaagatcaaaaaacaaaaaggtactggtactgcaagagcaggtagtatcaagtct
cctatctttaaaggtggtggacgtgtttttggaccaagaccaagaaattacggttttaaa
ttgaataaaaaccttaagcgtcttgctagaaaatctgcgctttctattaaagcaaatgat
aaggcaattatggtaatagaagatttttcattcgatactcctaagactaaaaacttcacg
gaagttcttaaggctctgggtattgaaagtaaaaaatctctaatagtgttgggcgattca
aataaaaatgtatatttgtcgtcgcgcaatttaaagacctctgaagtgataagtagttca
gaattaagtacttacaaaatacttaatgcgaaaagcatcgtctttttagaaggttcttta
gaaggaattgagtcgaaattaagttaa

DBGET integrated database retrieval system