KEGG   Gramella forsetii: GFO_2843
Entry
GFO_2843          CDS       T00448                                 

Symbol
rpsL
Name
(GenBank) 30S ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_2843 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_2843 (rpsL)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    GFO_2843 (rpsL)
  Bacteria
    GFO_2843 (rpsL)
  Archaea
    GFO_2843 (rpsL)
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-ProteinID: CAL67797
UniProt: A0M5A2
Position
complement(2946952..2947326)
AA seq 124 aa
MPTISQLVRKGRAKITKKSKSAALDSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNG
KEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVEGRTQRRSKYGAK
RPKK
NT seq 375 nt   +upstreamnt  +downstreamnt
atgccaacaatttcacaattagtacgaaaaggaagagccaaaataaccaagaagagtaaa
tcggctgctttggattcgtgccctcaaaggagaggtgtttgtacacgtgtgtacacaaca
actcctaagaaaccaaactcggctatgagaaaagtggccagggtaaggttgactaacgga
aaagaggtgaatgcctacattccgggtgaaggacacaatctacaggagcactcgatagta
ttggttagaggtggaagggtaaaagatttgcctggtgttagataccacattgtacgtggt
gcgctagatactgccggtgttgaaggtagaactcagcgtaggtctaaatacggagcaaaa
cgccctaagaagtaa

DBGET integrated database retrieval system