KEGG   Gramella forsetii: GFO_3341
Entry
GFO_3341          CDS       T00448                                 

Symbol
rpmF
Name
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_3341 (rpmF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_3341 (rpmF)
   03029 Mitochondrial biogenesis [BR:gfo03029]
    GFO_3341 (rpmF)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_3341 (rpmF)
  Bacteria
    GFO_3341 (rpmF)
Mitochondrial biogenesis [BR:gfo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GFO_3341 (rpmF)
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: CAL68282
UniProt: A0M6N7
Position
3505262..3505459
AA seq 65 aa
MAHPKRKISKTRRDKRRTHYKASAPKVAVDAVTGEAHLYHRAHWHEGKLYYRGQVLIDNT
EEVEA
NT seq 198 nt   +upstreamnt  +downstreamnt
atggcacatccaaagagaaaaatctcgaaaaccagaagagataagagaagaacacattat
aaagcttcagctccaaaagtggctgtagatgctgtaacaggtgaagcacacttgtatcac
agagctcactggcacgaaggtaaactatattaccgaggtcaggtattaattgataatact
gaagaagtagaagcatag

DBGET integrated database retrieval system