KEGG   Gramella forsetii: GFO_3502
Entry
GFO_3502          CDS       T00448                                 

Symbol
rplY
Name
(GenBank) 50S ribosomal protein L25
  KO
K02897  large subunit ribosomal protein L25
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_3502 (rplY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_3502 (rplY)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    GFO_3502 (rplY)
SSDB
Motif
Pfam: Ribosomal_L25p Ribosomal_TL5_C CBM27
Other DBs
NCBI-ProteinID: CAL68440
UniProt: A0M745
Position
3664300..3664962
AA seq 220 aa
MKSITINGSKRESVGKKATKALRNAGQVPCVLYGVEGDPLHFAAEEISFKNLVYTPDVHT
VKIKLKSGESYDAILQDIQFHPLTDAILHIDFYQIFGEKPITMEIPIHTEGVARGVKNGG
VLRYNLRRLKVRGLPADLPDYIVANVSKLKIGQKLYVTGVDSKDFVIQHPDNTVICQVRT
SRNLVELEDEDEDEDEVAADEVPATEVDDQAAVKEGEGKE
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaaatcaattacgatcaacggatctaaaagagaaagcgtaggcaagaaggcaacgaaa
gcactacgtaatgctggacaggttccttgcgtattgtacggggtagaaggtgatccacta
cactttgcagcagaggaaatatcattcaagaatttagtgtacactccagatgtacacact
gtaaaaatcaaattaaaaagtggagaatcttatgatgctatccttcaggatatccaattt
catcctttaacagatgcgattcttcatattgatttctaccagatctttggtgagaaacca
attactatggaaattccaattcacaccgaaggtgttgcaagaggggttaagaacggtggt
gtattaagatataaccttcgtcgtcttaaagtaagaggattaccagcagatcttccagat
tacatcgtagcaaacgtttctaagcttaaaattggtcagaagctttatgttactggagta
gatagcaaagactttgtgatccagcatccggataatactgtaatttgtcaggtaagaaca
tctcgtaaccttgtagaacttgaggacgaagatgaagacgaagacgaagtagcagcagat
gaagtaccagcaactgaagttgatgatcaggcagctgtaaaagaaggagaaggtaaagag
taa

DBGET integrated database retrieval system