KEGG   Gramella forsetii: GFO_3586
Entry
GFO_3586          CDS       T00448                                 

Symbol
rplU
Name
(GenBank) 50S ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_3586 (rplU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_3586 (rplU)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_3586 (rplU)
  Bacteria
    GFO_3586 (rplU)
SSDB
Motif
Pfam: Ribosomal_L21p Rho_N HeH
Other DBs
NCBI-ProteinID: CAL68524
UniProt: A0M7C9
Position
3749300..3749824
AA seq 174 aa
MYAIVEIAGQQFKVAKDQKVYVNRLAGEEGDSISFDKVLLTADGDSITVGAPAIDGALVG
AKINRHLKGDKVIVFKKKRRKGYRVKNGHRQALTEILIEGIDLKGGKKATSTKKAEPKKE
EAKKETKKSDDASSDKKSEDLSQNTVVELREMAKEKGVEGYSSMKKAELIAALS
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtacgcaattgtagagatagcagggcagcaatttaaagttgcaaaagaccaaaaggtt
tatgttaaccgtttagcaggagaagaaggagatagtatctcttttgataaagtacttctt
actgcagatggtgatagtataaccgttggcgccccggctatagatggagctcttgttgga
gccaaaatcaatcgtcacttaaaaggtgataaggttattgtattcaaaaagaaaagacgt
aaaggataccgtgttaagaacggccaccgtcaagctctaacagagattcttattgaaggg
atagaccttaaaggaggaaaaaaagctacttcaactaaaaaggctgagcctaaaaaagaa
gaagcaaagaaagaaactaagaagagtgatgatgccagttctgataaaaaatcagaagac
cttagccagaatacagttgtagaacttagagaaatggctaaagaaaaaggtgttgaaggt
tattcttctatgaagaaagcagaattgattgctgcattaagctaa

DBGET integrated database retrieval system