KEGG   Gramella forsetii: GFO_3587
Entry
GFO_3587          CDS       T00448                                 

Symbol
rpmA
Name
(GenBank) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
gfo  Gramella forsetii
Pathway
gfo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gfo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GFO_3587 (rpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gfo03011]
    GFO_3587 (rpmA)
Ribosome [BR:gfo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GFO_3587 (rpmA)
  Bacteria
    GFO_3587 (rpmA)
SSDB
Motif
Pfam: Ribosomal_L27
Other DBs
NCBI-ProteinID: CAL68525
UniProt: A0M7D0
Position
3749850..3750110
AA seq 86 aa
MAHKKGVGSSKNGRESESKRLGVKIFGGQAAIAGNIIVRQRGTAHRPGDNVYAGKDHTLH
ARVDGLVKFTKKKDDKSYVSIEPFEA
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcacataaaaaaggagttggtagttccaagaacggtagagaatcagaatcaaaacgc
ttaggtgtgaagatttttggtggacaagctgctattgctggaaatatcattgtaagacaa
agaggtactgcacatcgtccaggtgacaatgtttacgcaggaaaagatcatacgctacac
gctagagtagatggtcttgtaaagtttacaaaaaagaaagatgataaatcttatgtttct
attgagccttttgaagcttaa

DBGET integrated database retrieval system