KEGG   Gallus gallus (chicken): 100857781
Entry
100857781         CDS       T01006                                 

Gene name
PPP1R1A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 1A
  KO
K08050  protein phosphatase 1 regulatory subunit 1A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100857781 (PPP1R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    100857781 (PPP1R1A)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100857781 (PPP1R1A)
SSDB
Motif
Pfam: DARPP-32
Other DBs
NCBI-GeneID: 100857781
NCBI-ProteinID: XP_025001428
CGNC: 65275
Position
33
AA seq 173 aa
MEPNGPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPASLVLSSDQSSPEIDEDRLPNALLK
SGLAMSPRQKKKVYCTTPTVKELQMMVEHHLCKQARGEEDEEAAVGAPERSPGCCHHGDA
EHSHSPGGGCPLAQAQPAPHGGPADRTRGDERQSVGEESAHIAPGGKGAAGGV
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaacccaacgggccccgtaagatccaattcaccgtaccgctgctggagccgcacctc
gacccggaggcggcggagcagatccgccgacgccgaccgacgcccgccagcctggtgctg
agcagcgaccaatcgtccccagagatcgatgaggaccgactccccaacgccctgctgaag
tcgggtctggccatgtcgccccggcagaagaagaaggtttactgcaccacccccaccgtg
aaagagctgcagatgatggtggagcaccacctgtgcaagcaggcgcggggcgaggaggac
gaggaggcggccgttggagccccggagcgcagcccgggctgctgccaccacggcgacgcc
gagcacagccacagccccgggggcggctgcccgctggcccaggctcagcccgcaccgcac
ggcggccccgcggacaggacccgcggggatgagcggcaaagtgtgggtgaggagagcgcc
catatagcaccggggggaaagggtgctgccggcggcgtgtag

DBGET integrated database retrieval system