KEGG   Gallus gallus (chicken): 100858156
Entry
100858156         CDS       T01006                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100858156 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100858156 (PPP1CA)
   04218 Cellular senescence
    100858156 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100858156 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100858156 (PPP1CA)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100858156 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100858156 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100858156 (PPP1CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100858156 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    100858156 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    100858156 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:gga03019]
    100858156 (PPP1CA)
   03041 Spliceosome [BR:gga03041]
    100858156 (PPP1CA)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100858156 (PPP1CA)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100858156 (PPP1CA)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100858156 (PPP1CA)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100858156 (PPP1CA)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100858156 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100858156
NCBI-ProteinID: XP_015128130
CGNC: 64921
Ensembl: ENSGALG00000040016
Position
5
AA seq 330 aa
MADTEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPAGRPVTPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcggacaccgagaagctgaacctcgactccatcatcggccgcctcttggaggtgcaa
ggctcacggcccgggaagaacgtccagctgacagagaacgagatccgggggctgtgcctg
aagtcacgggagatattcctgagccagcccatcctgctggagctggaggcccccctcaag
atctgcggtgacatccacgggcagtactacgacttgctgcggctctttgagtacgggggc
tttccccccgagagcaactacctgttcctgggtgactacgtggaccggggcaaacagtcg
ctggagaccatctgcctgctgctggcctacaagatcaagtaccccgagaacttcttcctg
ctgcgtggcaaccacgaatgtgccagcatcaaccgcatctacggtttctatgacgagtgc
aagcggcgatacaacatcaagctgtggaagaccttcaccgactgcttcaactgcttgccc
attgctgccattgtggatgagaagatcttctgctgccatggagggctgtcccctgacctg
cagtcgatggagcagatccggcgcatcatgcgacccacggacgtgcccgaccagggcctg
ctgtgtgacctgctctggtctgaccctgacaaggatgtgcagggctggggcgagaacgac
cgcggcgtctccttcacctttggggctgaggtggtggccaagttcctgcacaagcacgac
ctggacctcatctgccgggcacaccaggtggtggaggatggctacgagttctttgccaag
cgccagctcgtcaccctcttctctgcacccaactactgtggggagttcgacaacgcaggc
gccatgatgagcgtggatgagacgctgatgtgctccttccagattctgaaaccggcagac
aagaacaagggcaagtatgggcaattcagtgggctgaaccccgccggccgccccgtcacc
ccgccacgcaactctgccaaagccaagaagtga

KEGG   Gallus gallus (chicken): 396019
Entry
396019            CDS       T01006                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    396019 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    396019 (PPP1CB)
   04218 Cellular senescence
    396019 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396019 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396019 (PPP1CB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    396019 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396019 (PPP1CB)
   04270 Vascular smooth muscle contraction
    396019 (PPP1CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    396019 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396019 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    396019 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:gga03019]
    396019 (PPP1CB)
   03041 Spliceosome [BR:gga03041]
    396019 (PPP1CB)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     396019 (PPP1CB)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     396019 (PPP1CB)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     396019 (PPP1CB)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     396019 (PPP1CB)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    396019 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 396019
NCBI-ProteinID: NP_990453
CGNC: 49609
Ensembl: ENSGALG00000010026
UniProt: P62207
Position
3
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggatggggagctgaacgtggacagcctcatcacccggctgctggaagtacgagga
tgtcgtcctgggaagattgttcaaatgacagaagcagaagttcggggcctgtgcataaaa
tcacgagaaatatttcttagccagcctattctcctggaactagaggcaccgctgaaaatc
tgtggtgatattcatggtcagtatacagatttgcttagactgtttgaatatggaggattc
ccaccagaagcgaattatcttttccttggagattatgtggacagaggcaaacaatctctg
gaaacaatttgcctacttctggcatataaaatcaagtacccggagaacttctttctctta
agaggaaatcatgagtgcgctagcatcaaccggatctatggattctatgatgaatgtaag
cggaggtttaatattaagctctggaagaccttcacagactgttttaattgtctgcctatt
gcagccattgtggatgagaagatcttctgctgtcatggaggactgtctccagatctccag
tcaatggagcagatccggagaattatgagacctacagatgttcctgacacaggcttacta
tgtgacctgctgtggtctgacccagacaaagatgtgcaaggttggggtgaaaatgatcgt
ggggtctcttttactttcggtgctgatgtggtcagtaaatttctgaatcgtcatgatttg
gatttaatctgtcgagctcaccaggtggttgaagatggatacgaattctttgctaaacgg
cagttggtcaccctattctcagctccaaattattgtggagagtttgacaatgcaggtggc
atgatgagtgtggacgaaactctgatgtgttcctttcagatattgaagccatctgaaaag
aaagccaagtaccagtatggtggactgaattctgggcgtccagtcactccacctcgcaca
gctaatcctccgaagaagaggtga

KEGG   Gallus gallus (chicken): 416872
Entry
416872            CDS       T01006                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    416872 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    416872 (PPP1CC)
   04218 Cellular senescence
    416872 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    416872 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    416872 (PPP1CC)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    416872 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416872 (PPP1CC)
   04270 Vascular smooth muscle contraction
    416872 (PPP1CC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    416872 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    416872 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gga03021]
    416872 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:gga03019]
    416872 (PPP1CC)
   03041 Spliceosome [BR:gga03041]
    416872 (PPP1CC)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     416872 (PPP1CC)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     416872 (PPP1CC)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     416872 (PPP1CC)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     416872 (PPP1CC)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    416872 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 416872
NCBI-ProteinID: NP_001006190
CGNC: 50363
Ensembl: ENSGALG00000004571
UniProt: Q5ZL39
Position
15
AA seq 323 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRSMITKQAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggatatagacaagctgaacatcgacagcatcatccaacggctgctggaggtgaga
ggatcaaaaccaggtaaaaatgtccaacttcaagagaatgaaatcagaggactgtgcttg
aaatccagagaaatctttctcagtcagcctattctgctagaacttgaagctccactgaaa
atatgtggtgacatccatggacaatactatgacttgcttcggctctttgaatatggaggc
tttccaccagaaagcaactacctattccttggtgactatgttgacagaggaaagcagtct
ttagaaacaatttgtcttctactggcctacaaaattaaatatccggagaactttttcctc
ctcagagggaaccatgaatgtgccagcattaatagaatttatggattttatgacgaatgt
aagagaagatacaacattaagctgtggaagacattcacagattgttttaactgtttacca
attgcagcaattgtggatgagaagatattctgctgtcacggaggtttgtcaccagacctt
cagtcaatggaacagatcagacgaattatgcgccccactgatgtacctgaccagggtctc
ctttgtgatctcctgtggtctgaccctgacaaagatgtcttaggatggggtgaaaatgac
agaggagtgtcctttacttttggtgctgaagtggttgctaagtttctccataaacatgat
ttggatctcatatgtagagctcatcaggttgtggaagacggatatgagttttttgcaaaa
agacaattggtaactctcttttctgccccaaattactgtggagaatttgataatgcaggt
gccatgatgagtgtggatgaaaccttaatgtgttcttttcagattttgaaacccgcagag
aagaagaagcccaatgctagcagacctgtaacacctcccaggagtatgatcacaaagcaa
gcgaagaaatag

DBGET integrated database retrieval system