KEGG   Gallus gallus (chicken): 100858946
Entry
100858946         CDS       T01006                                 

Gene name
CACNA2D4
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-4
  KO
K04861  voltage-dependent calcium channel alpha-2/delta-4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100858946 (CACNA2D4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100858946 (CACNA2D4)
   04261 Adrenergic signaling in cardiomyocytes
    100858946 (CACNA2D4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    100858946 (CACNA2D4)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100858946 (CACNA2D4)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 VWA_2 VWA dCache_1 VWA_CoxE CobT_C
Other DBs
NCBI-GeneID: 100858946
NCBI-ProteinID: XP_015141621
CGNC: 66086
Position
1
AA seq 1094 aa
MWKAKPAHGHLHPSAGATCSDMVMEPIVGSPKPVLWAAFTSAAMQPTRIAVARTQPQEAQ
ETGGWKYKDVEPTLKIKEVDGLELVKKFSEQMESMLRRKVEAVERLVEAAEDADLNHEYN
SSLEFDYYNSLLINEKDENDNYVELGDEFILEPNEHFNNLLVNTTYSDIQLPTNVYNKDP
DILNGVYMSEALNPVFVDNFERDPTLTWQYFGSSTGFFRLYPGIKWLPDENGVISFDCRN
RGWYIQAATSPKDIVIIVDVSGSMKGLRMTIAKHTIVTILDTLGENDFVNIIAYNDYVHF
IEPCFKGILVQADRDNREHFKQLVDELQAKGVGTVNKALTESFKILREFRDAGQGGLCNQ
AIMLITDGAVEDYEAVFEKYNWPDRKVRVFTYLIGREVTFAPNVKWIACNNKGYYTQIST
LADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDSALFASQAQSLLLMTTVAMPVFSKK
NETRSHGILLGVVGSDVPLRELLKLAPRYKLGVHGYAFLNTNNGYILSHPDLRPLYKEGK
KLKPKPNYNSVDLSEVEWEDQDEILRTAMINGETGYLSMDVKVPVDKGKRVLFLTNDYFF
TDISGTPFSLGVVLSRGHGEYILLGNTSVEEGLHDLLQPDLSLANEWIYCITDIDPDHRK
LSQLEAVIRFLTGEEPDLECDEELVQEVLFDAVVTAPMEAYWTTLALNMSTESEAGVEMA
FLGTRAGLMRSALYVGSEKLSNRKFLTRKDKESIFTMDHFPLWYRRAAEHPPGSFIYSIV
SEDDSEGGGLPKVVTVSTAVAVSVDGKMGIAAAVGVQIKLELLQRKFWMAMQQCSAFDGA
CPLSCQDDVLNCFLIDNNGFILVSKRPPEIGKFLGVVDGSVMTQLLNMGMFRRVTMYDYQ
AMCKVPYHHHSGARPLLSPIYAFLAALKWLISDFLIFLLEFNMSSFWHSENVADAKAVFH
HSHKHKKHDTLQPCDTEYPVFVYEPAIKETNGLIECGDCQKMFVAQQIASSNLLLLVTDA
TCDCSIFPPVLLDAKEVKYNASVKCDRMRSQKLRRRPDTCHAFHPEENAQDCGGAAELSV
SPMLLLLPPALLVR
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgtggaaggcaaaaccagctcatggacatcttcatcccagcgcaggtgcaacttgcagt
gatatggtcatggagccaatcgtaggcagcccaaagcccgtgctctgggctgctttcacg
agtgctgctatgcagcctacaaggatagctgtggccagaacccagcctcaagaggcacag
gagacgggtggttggaagtacaaagacgtggagccgaccctgaagatcaaagaggtggat
ggcctggagcttgtgaagaagttctcagagcagatggaaagcatgctccgcaggaaggtg
gaagctgttgagaggttggtggaagcagcagaggatgcagatctgaaccatgagtacaac
tcctcactggagtttgattactacaactccctcctgattaatgagaaggatgaaaatgac
aattatgtggagcttggcgatgaattcattctggagccaaatgagcatttcaataacctg
ctggtaaacacaacatacagtgatatccagctccctaccaacgtctacaacaaagatcct
gacatcctgaatggtgtttacatgtcagaagccttgaaccctgtctttgtggataacttt
gaaagggatcctacactgacctggcagtactttggtagctccacagggttcttcaggctc
tatccaggaataaagtggctaccagatgagaatggggtcatctccttcgactgcaggaac
cgtggctggtacatccaagcagccacatctcccaaggacatcgtcatcattgtggatgtc
agtggaagcatgaagggcctgcggatgaccattgccaaacacaccattgtcaccattcta
gatactcttggggaaaatgactttgtcaatatcattgcatacaatgattatgttcatttt
attgaaccctgttttaagggtatcctggtccaagcagacagagacaacagagagcatttc
aagcagctggtggacgaactgcaggcaaaaggagtgggaacggtgaacaaggccttgacg
gagtccttcaaaatcctgagggagttcagagacgctggccaagggggcttgtgtaaccaa
gccatcatgctgatcacagacggagcagtggaggattatgaagctgtgtttgaaaagtac
aactggccagatcggaaggtccgggttttcacttacctcattggacgggaggtcactttt
gcccccaacgtgaaatggatcgcttgcaacaacaaaggctactatacccagatctccaca
ctggcggacgtccaggagaacgtgatggagtacctgcatgttctcagccgtcctatggtc
atcaaccatgaccacgacattatatggactgaagcctacatggacagtgcgctctttgca
tctcaggctcaaagtctgttgctcatgacaacagtggctatgccagtcttcagcaagaag
aatgagacgcggtctcacggcattctcctgggtgtggtgggctctgatgtgccactgaga
gagttgttaaaacttgctccacgttataagctgggtgtccatggatatgcctttctgaac
accaacaatggctacatcctctcacacccagacctccgtcctttgtataaagaaggaaag
aaactgaagcctaagccaaactacaacagtgtggatctctcagaagtggaatgggaagac
caggatgaaatactgagaactgccatgatcaatggggaaacgggctacctctccatggat
gtgaaggtccccgtggataaagggaaacgagttctcttcctcacaaatgactatttcttc
acggacatcagtggcacacccttcagcctgggggttgtgctgtccaggggacacggcgag
tacattctgctggggaacacttcagtggaagaaggtttgcacgacctgcttcagccagac
ctgtctttagcaaacgaatggatttactgcatcacagacatcgatccagaccaccggaag
ctcagccagctggaggctgtgatccgtttcctcacgggagaggaacctgacctggaatgc
gatgaggagttggtccaggaagtgctgtttgatgcagtggtcactgcacccatggaagcc
tactggacaacactagccctcaatatgtccacggagtctgaggcaggggttgagatggca
tttctgggcactcgggctggactcatgaggagtgccctgtatgtgggctctgagaaactt
tccaacaggaaattcctgactcggaaggacaaagagagtatcttcaccatggaccacttc
cctctgtggtaccgccgggcagctgagcatccccccgggagcttcatctacagcatcgtt
tcagaagatgactcagagggcggcggcctaccaaaagtggtgacagttagcacggcagtg
gctgtatctgtcgatgggaagatgggtattgctgcagcggtgggcgtgcaaatcaagctg
gaattactccaacgcaagttctggatggccatgcagcagtgcagtgcctttgatggtgcc
tgtccactcagctgtcaggacgacgttctgaattgctttctcattgataataatggcttt
atcctcgtttccaaaagacctccagagattggaaaatttcttggtgtggtggatggctca
gtaatgacccagctactgaacatgggcatgttcaggcgggtgacaatgtatgactaccaa
gcaatgtgcaaggtgccctaccaccaccacagtggtgcccggccgctgctcagtccaatt
tatgcctttctagctgcactgaaatggctgataagtgatttcctcatcttcctgttggag
tttaacatgagtagcttctggcattccgaaaacgtggcagacgccaaggctgtcttccat
cactcccacaagcacaagaagcacgacacgctgcagccctgcgacacagagtaccccgtc
ttcgtgtacgagccggccatcaaggagaccaacgggctgatcgagtgcggggactgccaa
aagatgtttgtggcccagcagattgccagcagcaacctgctgcttcttgtcacagatgcc
acctgcgactgcagcatcttcccacctgtcctgctggatgcgaaggaagtcaaatacaac
gcatcggtgaagtgtgaccgcatgcgctcccagaagctgaggcggcgaccagacacgtgc
cacgcatttcaccccgaggagaatgcccaggactgtggcggtgctgctgagctctctgtc
tcccccatgctgctcctcctgcccccagcactgctggtgcggtga

KEGG   Gallus gallus (chicken): 107050029
Entry
107050029         CDS       T01006                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-3 isoform X1
  KO
K04864  voltage-dependent calcium channel beta-3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107050029
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107050029
   04261 Adrenergic signaling in cardiomyocytes
    107050029
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    107050029
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107050029
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N DUF6374
Other DBs
NCBI-GeneID: 107050029
NCBI-ProteinID: XP_025001451
CGNC: 73044
Position
33
AA seq 510 aa
MSAPTQPSSPGSFQSPRRIPKRKSRFKRSDGSTSSDTTSSVLRRQGSADSYTSRPSLDSD
ASLEEDRERREGQSRAQQQLERAKHKPVAFAVRTNVSYCGALDEECPLQGAAINFEAKDF
LHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLEAVRLKQEQRARRAGSAPGIGDSGSRRS
PPPSLAKQKQKQTQHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRI
SITHITADLSLAKRSILNNVGKQALLERSAARSTIAEVQSEIERIFELAKSLQLVVLDAD
TINHPAQLAKTSLAPIIVYVKVSSPKVLQRLIKSRGKSQVKHLNVQMMAADKLVQCPPEL
FDVILDENQLEDACEHLAEYLEVYWRATHHPPHSPHAVPSPSSLPGLQGQQLLEERGEHS
PLEHDSLMPSDEASDPSPRAWGGPTQRSSRHLEEEEEYGGPYPDLYQPHRHHNSGLHGPP
SAPTAAQERLLERDPDRNWQRSRPWAKDSY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtccgctccgacgcagccgtcctcacccggttcgttccagagcccccgaaggatcccg
aaacggaaaagccgcttcaaacggtccgacggcagcacttcgtccgacaccacgtccagc
gtcctccggcggcagggctcggccgattcctacaccagccgcccctctctggactcggac
gcgtccctggaggaggaccgcgagcggcgcgaggggcagagccgtgctcagcagcagctc
gagagggccaagcacaaacccgtcgccttcgccgtgcgcaccaatgtcagctactgcgga
gcgctggatgaggagtgcccgttacagggggcagcaattaacttcgaggccaaagatttc
ctgcacattaaagagaaatacagcaatgattggtggatcgggcgcttagtgaaggagggg
ggggacatcgccttcatccccagcccgcagcgcctggaggccgtgaggctcaaacaggag
cagagagcgcggagagctggaagcgctccgggcattggtgacagcgggagccggcgatcg
ccccccccttcattagccaaacagaagcagaaacagacgcagcacatccccccctacgat
gtggtgccctccatgcgccccgtggtgttggtggggccctccctaaagggatacgaggtc
accgacatgatgcagaaagcgctcttcgatttcctcaagcacagatttgacggcaggatc
tccatcacccacatcacggcggatctctccttggccaaacgctccatcctcaacaacgtg
ggcaaacaggcgctcctcgaacgctcggccgcgcgctccaccatcgcggaggtgcagagt
gagatcgagcgcatcttcgagctggccaagtcgctgcagctggtggtgctggatgctgac
accatcaaccaccccgcacagctggccaagacctcgttagcacccatcatcgtctacgtc
aaagtgtcctcccccaaggtcctccagcggctcatcaaatcccgtggcaaatcgcaggtg
aagcacctcaacgtgcagatgatggcagcggacaaactggtgcagtgccccccggagctg
tttgatgtcatcctggatgagaaccagctggaggatgcctgcgagcacctggctgagtac
ctggaggtgtactggcgtgccacgcaccacccaccccacagcccccacgctgtgccctcc
cccagcagcctcccagggctgcagggccagcagctgctggaggagcggggtgagcactcc
cccctggagcacgacagcctgatgccatcagacgaggccagcgatccctccccccgtgcg
tgggggggtccaacccagcgcagctcacggcacctggaggaggaggaggagtacgggggg
ccctaccccgacctctaccaaccacaccgacaccacaactcggggctgcacggccccccc
tcggcccccaccgcagcacaggagcggctcctcgaacgggaccccgataggaactggcag
cgcagccggccctgggccaaggacagctattag

KEGG   Gallus gallus (chicken): 107050634
Entry
107050634         CDS       T01006                                 

Gene name
CACNG7
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107050634 (CACNG7)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107050634 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    107050634 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    107050634 (CACNG7)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107050634 (CACNG7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 107050634
NCBI-ProteinID: XP_025001289
CGNC: 73648
Ensembl: ENSGALG00000042886
Position
33
AA seq 156 aa
MGDLGPVSGAPPDPPLTPPPITGLSLVVGLVLYISSINDEVMNRPSGSEQYFQYRYGWSF
AFAASSFLLKEGAGVMSVYLFTKRYAEEELYRTPAALLRPRLSACSGLSGQFLQPRAWPR
ARSPSDASSDVSIQMTQSYPPAIXYPPRGRLSTSPC
NT seq 471 nt   +upstreamnt  +downstreamnt
atgggggatttggggcctgtctctggtgcccccccggacccccccctgacgccccccccc
attacaggcctgtcgctggtggtgggcctggtgctctacatctccagcattaacgacgag
gtgatgaaccgccccagcggctccgagcagtacttccagtaccgctatggatggtccttc
gccttcgccgcctcctccttcctcctcaaagagggcgccggggtgatgtcggtgtatctg
ttcaccaaacgctacgcggaggaggagctgtaccgcaccccggcggcgctgctgcggccg
cggctcagcgcgtgttcggggctgtccgggcagttcctgcagccccgcgcgtggccccgc
gcccgcagcccctccgacgcctcttccgacgtctccatccaaatgacgcagagttacccc
cccgccatcncataccccccccgggggaggctctccacgtcgccgtgctga

KEGG   Gallus gallus (chicken): 373924
Entry
373924            CDS       T01006                                 

Gene name
CACNG4
Definition
(RefSeq) voltage-dependent calcium channel gamma-4 subunit
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    373924 (CACNG4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    373924 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    373924 (CACNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    373924 (CACNG4)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   373924 (CACNG4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269 DUF4199
Other DBs
NCBI-GeneID: 373924
NCBI-ProteinID: NP_989463
CGNC: 66180
Ensembl: ENSGALG00000026091
UniProt: Q90X18
Position
18
AA seq 328 aa
MVWCDRGVQMLLTTVGAFAAFSLMAIAIGTDYWLYSSAHICNGTNITTDDTQGPPKKARG
DLTHSGLWRICCLEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLL
LGGLCVGAGRIYNSKNNIILSAGILFVAAGLSNIIGIIVYISSNAGDPSDKRDEDKKNHY
NYGWSFYFGALSFIVAETIGVLAVNIYIEKNKELRFKTKREFLKTSSSSPYARMPSYRYR
RRRSRSSSRSTEPSPSRDISPVGMKIASTIPMNEISMYTLSREPLKVTTAASYNADQEAS
FLQVHNFLQKEFKEGLHVNMVNRRTTPV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggtgtggtgtgaccgtggcgtccagatgctgctgaccacggtgggagctttcgccgct
ttcagcctcatggccatcgccatcggtaccgactactggctgtactccagcgcgcacatc
tgcaacggcaccaacatcacgacggacgatacgcaggggccgccgaagaaagcgaggggc
gacctcacgcattcggggctctggaggatctgctgcctcgaaggaatctacaaaggacac
tgcttccgaatcaaccacttccctgaagacaacgactacgaccatgacagctcagaatac
cttctccgcattgtccgtgcctccagtgtgttccccattctaagcacaatattgctgctg
ctgggagggctctgtgttggagcagggaggatttacaacagcaaaaacaacattattctc
agcgctggaattctctttgtcgcagcaggcctaagtaatatcatagggatcattgtctac
atatcaagcaacgcaggtgacccaagtgataagcgagatgaggacaaaaagaaccattac
aactacggttggtctttctattttggagccttgtcttttatcgtggccgaaaccataggt
gttctggctgtgaacatttatattgagaagaacaaagagctgaggtttaagaccaagagg
gaattccttaagacttcttccagttctccttatgccaggatgccaagctacaggtacagg
aggcggaggtccaggtccagttctcgatccacagaaccttctccatctagagacatttcc
ccggttggcatgaagatagcaagcaccattcccatgaacgagatttccatgtacactctt
tccagagagcccttgaaggtcacaacggccgccagctacaacgcagaccaagaagccagt
tttctgcaggtccacaacttccttcagaaggaatttaaggaaggactccacgtcaacatg
gtcaacaggagaacaacacctgtctga

KEGG   Gallus gallus (chicken): 374259
Entry
374259            CDS       T01006                                 

Gene name
CACNB4
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-4 isoform a
  KO
K04865  voltage-dependent calcium channel beta-4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    374259 (CACNB4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    374259 (CACNB4)
   04261 Adrenergic signaling in cardiomyocytes
    374259 (CACNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    374259 (CACNB4)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   374259 (CACNB4)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 374259
NCBI-ProteinID: NP_001001733
CGNC: 49105
Ensembl: ENSGALG00000035466
UniProt: B6IDG6 Q804I4 Q804I5
Position
7
AA seq 401 aa
MYDNLYLHGFEDSEAGSADSYTSRPSDSDVSLEEDREAIRQEREQQAAIQLERAKSKPVA
FAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSP
LRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTAKQKQKVTEHVPPYD
VVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNP
SKRAIIERSNTRSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHV
KVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLAEY
LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPAAISGLQG
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtacgacaatttgtacctgcatggatttgaagactcggaggcgggctcagcagattcg
tacacaagcagaccctcagactctgatgtgtctttggaagaggacagggaagcgatccgc
caggagagagagcagcaagcggcgatacagctcgaaagggcaaagtccaaaccagtagcg
tttgctgttaagaccaatgtgagttactgtggagctctggatgaagatgtccctgtccca
agcactgccatctcttttgatgcgaaggacttcctacacattaaagagaaatacaataat
gactggtggatagggagactggtgaaggagggctgcgaaattggtttcattccgagcccg
cttagactggagaatatccgcatccagcaggagcagaagagaggacgtttccatggaggg
aaatcaagtgggaattcttcttcaagtcttggagaaatggtttccggcacgtttcgagcc
acacctacttccacagcaaaacagaaacaaaaagtgacagaacacgttcccccgtacgac
gtggtgccctcaatgaggcccgttgtcttggtggggccgtcgctgaaaggctatgaggtg
acagacatgatgcagaaagctctctttgacttcctgaagcacaggtttgatgggaggata
tcaataacccgagtgacagccgacatttctcttgctaagaggtctgttctgaataaccca
agcaagagggcaataattgaacggtcaaacacacgatccagtttagctgaagtgcagagt
gagattgaaagaatctttgagctggcccggtccttgcagctggttgtcctggatgcagac
actatcaatcaccccgcacaacttatcaagacatctctagcaccaattattgtccacgtt
aaagtgtcttctccaaaggttttgcagcgactgattaaatctagaggaaagtcacaaagt
aaacacttgaatgttcagttggtggcagctgataaacttgcacaatgcccaccagagatg
tttgatgtaattttggatgaaaaccagctcgaagatgcttgcgaacacttggcggagtac
ctggaggcgtactggcgtgctacgcacaccaccagtagcacacccatgactcctcttctc
gggagaaacttaggatccactgcactgtccccataccctgctgcgatctctggactgcag
gggtag

KEGG   Gallus gallus (chicken): 395378
Entry
395378            CDS       T01006                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395378 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395378 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    395378 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395378 (CACNG3)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   395378 (CACNG3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 395378
NCBI-ProteinID: NP_989991
CGNC: 4512
Ensembl: ENSGALG00000038087
Position
14
AA seq 316 aa
MRMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSGGDNDTSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKNSYSYGWSF
YFGALSFIIAEMVGVIAVHMYIEKHRQIRARSHSELLKRSAFTRLPPYRYRFRRRSSSRS
TEPRSRDMSPISKGFGTIPSTDISMFTLSRDPSKVTMGTLLNSERDHGFLQVHNSIPKEF
KESLHNNPANRRTTPV
NT seq 951 nt   +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggcgtccagatgctcatcaccacggtgggagccttcgcagcc
ttcagcctgatgaccatcgccgtgggcaccgactactggctctactcgcgcggcgtgtgc
aggactaagtccggcggcgacaacgacacgagccgcaagaacgaggaggtgatgacccac
tcggggctctggaggacgtgctgcctggaaggaaccttccgaggagtctgcaagaagatc
gaccactttcctgaggatgcggactacgagcaggacacagctgaatacctcctccgtgct
gtcagagcctccagcatcttccccatcctcagcgtgggcctgctcttctttggggggctg
tgcgtggcagccagcgagttctacaaaactcgacacaacatcatccttagtgccggcatc
ttcttcgtctcagcaggtctcagcaacatcattgggatcatcgtctacatctcagccaac
gcaggggacccggggcagagcgactccaagaagaacagctactcctacggctggtccttc
tacttcggcgctctgtccttcatcattgccgagatggtgggggtgatcgccgtgcacatg
tacatcgagaagcaccgccagatccgcgccaggtcccactcggagctgctgaagcggtcg
gcattcacccgcctgcccccctaccggtaccgcttccgccggcggtccagctcacgctcc
accgagccgcgctcccgggacatgtcgcccatcagcaagggcttcggcaccatcccctcc
actgacatctccatgttcaccctctccagggatccctccaaggtcaccatggggacactg
ctcaactcggagcgggaccacggttttttacaggtccacaactccatccccaaagagttc
aaggagtctttgcacaacaacccggccaacagacgaaccacgccggtctga

KEGG   Gallus gallus (chicken): 395891
Entry
395891            CDS       T01006                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395891 (CACNA1C)
   04020 Calcium signaling pathway
    395891 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395891 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395891 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    395891 (CACNA1C)
   04270 Vascular smooth muscle contraction
    395891 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395891 (CACNA1C)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   395891 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 395891
NCBI-ProteinID: XP_015141927
CGNC: 49535
Ensembl: ENSGALG00000013022
Position
1
AA seq 2202 aa
MFQAFVRQAYQPLSSHQQGESETKYRGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNRSTPAGLPDKKKEKFSWFSHSTETHVSMPTSETESVNTDNVPGTDIEGE
NCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYN
QPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVE
TKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSL
LGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGM
LVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKK
QEIEKTAVEEETKEEKIELKSITADGESPPATKINMDDYQPNENEEKSPYPTTEAPAEED
EEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLIL
FFILLSSISLAAEDPVRHLSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRN
YFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIR
TIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQ
PRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFI
IYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ
YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMV
LKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAENTQCSSSMNAEENSRISITF
FRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL
NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPDSEPANSTEADHSC
GSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDKA
MKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKSGNNQGDTES
PSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTI
RVQEAPWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSL
LSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGV
DVSQKTVLPLQMVHHQALAVAGLSPLLQRSHSPTTFSRLCATPPATPCSRGWPQQPIPTL
RLEGAESSEKLNSSFPSVHCSSRFPDSSDCGSPRRARPVSLTVPSPTAGSSRQFHGSASS
LVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLL
PFVNCRDAGQDSAGEEEEEVQNPDCRKSQEELKDSRIYISSL
NT seq 6609 nt   +upstreamnt  +downstreamnt
atgtttcaagcctttgttcggcaagcataccaaccgctatccagccaccagcaaggggaa
tctgaaacgaagtacagggggaagctggtgcatgaaactcagctcaactgcttctacatc
aaacctggaggttccaattatgggagtccccgtccagctcatgccaacatgaatgccaat
gcagctgcagggcttgccccagagcatatccctacaccaggggcagctctgtcctggcaa
gctgcaattgatgctgccaggcaagccaaattgatgggtagtgctggcaatgcaacaata
tccacagctagctccacgcagagaaaacggcagcagtacgggaaacagaaaaaacagggt
accacgacagctacgcgtcctccccgggcactgctgtgtttaacactgaaaaatcccatc
cggagggcatgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggatttgatgtt
aaagcactgcgggctttccgagtattacgtcccttacgactggtgtctggagttcctagt
ctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcatcattatctatgccatcattggactggagttattcatgggaaag
atgcataagacctgctaccacgtgcaagggggactgatagatacgcctgcagaagatgac
ccatctccctgtgccccccagtccgcacatgggcggcagtgccagaatggaaccgagtgc
aaggcaggctgggagggacccaagcacggcattacgaactttgacaattttgcttttgcc
atgctgacagtgtttcagtgcatcacgatggaggggtggacagatgtactctactggatg
caggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtcatctttgga
tcctttttcgttctaaatctggtacttggtgtgttgagcggggaattttccaaggaaaga
gagaaggctaaggctcggggagatttccagaagttacgggaaaagcaacagctagaggag
gatttgaagggctatttagactggataactcaagcagaagatattgacccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacagaagcactccagctggcttgcctgat
aagaagaaagaaaagttttcttggtttagtcactccacagaaacccatgtgagcatgccc
accagtgagaccgagtccgtgaacacagacaacgtccctggaacagatattgaaggcgaa
aactgcggtgctaggctagcgcatcggatctccaaatctaaatttagtcgctattggcgc
cgatggaatcgattctgcagacgaaagtgccgtgctgctgtcaagtccaatgttttctac
tggttggtgatcttccttgtgtttctcaacacccttaccattgcctctgaacactacaac
cagccagactggctcactgaggttcaagacactgccaataaggtgctgctagctcttttc
acggcagagatgctgctgaagatgtacagcctcggtctccaggcctattttgtgtccctc
ttcaaccgctttgactgtttcattgtgtgtggaggaatcctggaaacaattctggttgag
acgaagatcatgtcaccattgggcatttctgtgttgagatgtgttcggctattaagaata
tttaaaatcacaagatattggaactccctgagtaacctagtggcttcactcctgaattca
gtccgttccattgcctccctcctgctgctcctcttcctcttcatcatcatcttctcactg
ctggggatgcagctttttgggggcaagtttaactttgatgaaatgcagaccaggaggagt
acatttgacaacttcccccagtccctcctcactgtgtttcagatcctgactggggaggac
tggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatg
ttggtctgtatttacttcatcatcctcttcatctgtgggaactacatcctgctgaatgta
tttttggccattgctgtggacaaccttgctgatgcggagagtttaacatctgcacagaag
gaagaggaagaggaaaaagaaaggaaaaaactagctaggactgctagtcctgaaaagaaa
caggagatagagaaaacagctgtggaggaggagacaaaggaggagaaaattgagctgaaa
tcaatcactgctgatggagaatccccacctgctacgaagatcaacatggatgactatcag
ccaaacgaaaatgaagaaaagagcccatatcccacaacagaagcaccagcagaggaagat
gaggaagaacctgaaatgcctgtcggccctcggcctcgcccaatgtctgagctgcacctc
aaggaaaaggctgtgcccatgcctgatgccagcgcttttttcatcttcagtcctaacaac
aggttccgtgtccactgccatcgaatcgttaacgataacattttcaccaacctgatccta
tttttcatcttgctcagcagcatctccttggcagctgaggaccccgtccgacacctctcc
tttaggaaccaaatcctaggcaatgcagactatgtcttcactagtatctttacattagaa
attattcttaagatgaccgcatacggggctttcctccataagggctccttctgcagaaac
tatttcaacatcttagacctgctggtggtcagcgtttctctcatctcttttggaatccaa
tccagtgccatcaatgtggtgaagattttgcgtgttctgcgagtgcttcgacctctgagg
gccatcaacagagccaaaggactaaagcatgtggtccaatgtgtgtttgttgccatccga
accatcggaaacattgtgattgtcaccactttgctgcagttcatgtttgcctgcattgga
gttcagttgtttaagggcaaactctacagctgtactgatagctccaagcagactgaagca
gaatgcagagggtactacatcacatacaaggatggtgaggtcagtcagccgatgatccaa
ccccggagctgggagaacagcaagtttgacttcgacaatgtcttgactgccatgatggcc
ctcttcactgtctcaacctttgaaggatggccagagttgctgtataggtccattgattcc
cacatggaggatgtgggacccatctataatcacagggttgagatctccatcttctttatt
atctacatcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtc
acatttcaggaacaaggagaacaagaatacaagaactgtgagctggacaagaaccagcgc
cagtgtgtagagtatgccctgaaggcccggcccctgcggagatacatcccaaaaaaccag
taccagtacaaagtttggtatgtggtcaactccacctattttgaatacctgatgttcgtt
ttgatcctgctgaacaccatctgtctggccatgcaacactacggtcagagctgcatgttc
aaggaagccatgaacatcctcaacatgctcttcactggcctcttcactgtcgagatggtc
ctgaagttaattgccttcaaacccaagcactatttctgtgatgcatggaatacatttgac
gccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaa
aatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttc
ttccgactcttccgcgtgatgcgtcttgtgaagctcctgagccgaggggagggcatccgg
acactgctttggaccttcatcaagtccttccaggctctcccctatgtggctcttctaata
gtgatgctgttcttcatctacgccgtgatcgggatgcaggtgtttggtaaaattgcactg
aacgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaagcggtgctg
ctgcttttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcgtgtctccca
gacaagaagtgcgaccccgactcagagccggccaactccaccgaagccgaccactcctgt
ggcagcagctttgctgtcttctacttcataagcttctacatgctctgtgccttcctgatc
atcaatctttttgtagctgttataatggataacttcgattacctgacacgggactggtcc
attttaggaccacaccacctagatgagtttaaaaggatctgggcagagtatgaccctgaa
gccaagggacggatcaagcacttggatgtggtgacactgctccggcggattcagcctcca
ctgggcttcgggaagctttgccctcaccgagtggcttgcaaacgccttgtctccatgaat
atgccactaaacagcgatggaactgtcatgttcaatgccaccctctttgcgctggtcaga
actgcactgaggatcaagacagaaggtaacctggagcaagccaatgaagagcttagagca
ataattaagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgcctcct
gcaggtgatgacgaggtgactgttgggaagttctacgccactttcctgattcaagagtat
ttccggaagttcaagaaacgcaaagagcagggcctggtgggcaagccttcccagcgcaac
gcactctccttgcagtttgctgttttgcaggctggtttgcgcacacttcatgacattggt
ccagagatccgacgagcgatctctggagacctgacagctgaagaagagctagataaggct
atgaaagaagctgtttctgctgcctctgaagatgatatcttccggagagccggaggcttg
tttggaaaccatgtcagctattaccaaagtgatggcaggagtgcattcccccagacattc
accacgcagagacctttgcacatcaataagtctggcaacaaccagggagataccgagtct
ccatctcatgagaagttggtggattctaccttcactcccagcagctactcatcttcaggc
tccaatgcaaacatcaacaatgccaacaacacagccctgtgccgcttcccaagcccaccc
agctaccccagcactgtcagcacagtggaaggccatgggactccattgtcacctaccata
cgtgtgcaagaagctccttggaaactaccttccaaaaggacgcactactacgaaacactg
ggacgctccagttccagagacagccagctggcaattgtttgccaagaggaagtgtctcag
gatgagacttatgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctg
ctctctactgaaatgctcgcataccaagatgacgaaaacagacaacttactccaccagaa
aacaacaaaggagaggacacccggcactctccgaagaaagggtttctgtgctcctcagct
ctaggtcgacgagcatctttccacttagagtgtctgaaaagacagaaaaaccagggcgta
gatgtctcgcagaagacagttctgcctttacaaatggtacatcatcaggcactggcggtg
gccggcctgagccccctcctccagcgaagccattcccccaccacgttctcccggctgtgc
gccacaccgcctgctacaccctgcagccgaggctggccacagcagcccatcccgacgctg
cgcctcgagggggctgagtccagtgagaagctcaacagcagcttcccctccgtgcactgc
agctcccggttccccgacagctctgactgtggcagcccaaggagagccaggccggtgtcc
ctcaccgtccccagcccgacggcagggagcagcaggcagttccatggcagcgccagcagc
ctggttgaagcggtgttgatttcggaaggactgatgcagtttgctcaagatccaaagttc
attgaggtcacgacccaggaactcgctgacgcctgtgacatgacgatagaagagatggaa
aacgcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctgttg
ccttttgttaactgcagggacgcagggcaggacagtgcaggcgaggaagaggaagaggtg
cagaacccggattgtagaaaaagtcaggaggagctgaaggacagcaggatttatatcagc
agcctgtag

KEGG   Gallus gallus (chicken): 395895
Entry
395895            CDS       T01006                                 

Gene name
CACNA1D
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04218  Cellular senescence
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04530  Tight junction
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395895 (CACNA1D)
   04020 Calcium signaling pathway
    395895 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    395895 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    395895 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395895 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395895 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    395895 (CACNA1D)
   04270 Vascular smooth muscle contraction
    395895 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395895 (CACNA1D)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   395895 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834 Rer1
Other DBs
NCBI-GeneID: 395895
NCBI-ProteinID: NP_990365
CGNC: 49537
Ensembl: ENSGALG00000005332
UniProt: O73700
Position
12
AA seq 2190 aa
MQHHQQQQPEQHPEEANYASSTRIPLPGDGPTTQSNSSAPSKQTVLSWQAAIDAARQAKA
AQNMNTTTAQPVGSLSQRKRQQYAKSKKQGNTSNSRPPRALFCLSLNNPIRRACISLVEW
KPFDIFILLSIFANCVALAVYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGL
LLHPNAYVRNGWNLLDFVIVVVGLFSVILEQLTKETEGGSHSGGKPGGFDVKALRAFRVL
RPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKSCFLID
SDILVEEDPAPCAFSGNGRQCVMNGTECKGGWVGPNGGITNFDNFAFAMLTVFQCITMEG
WTDVLYWVNDAIGCEWPWIYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKL
REKQQLEEDLKGYLDWITQAEDIDPENDEEADEEGKRNRVTLADLMEEKKKSRLSCFGRS
SNKHASMPTSETESVNTENVSGEGENPACCGSLCQTISKSKFSRRWRRWNRFNRRKCRAA
VKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGL
QAYFVSLFNRFDCFVVCGGIVETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNL
VASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVF
QILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAE
SLNTAQKEEAEEKERKKNARKESLENKKSEKSEGDQKKPKDSKVTIAEYGEGEDEDKDPY
PPCDVPVGEDEEDEEDEPEVPAGPRPRRISELNMKEKITPIPEGSAFFIFSSTNPIRVGC
HRLINHHIFTNLILVFIMLSSVSLAAEDPIRSHSFRNNILGYADYVFTSMFTFEIILKMT
AFGAFLHKGSFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAK
GLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYKCTDEAKQNPEECRGIY
IVYKDGDVDNPMVKERVWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVG
PVYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYA
LKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAMQHYGQSKLFNDAMDI
MNMVFTGVFTVEMVLKLIAFKPKIFVRKKERWLGYFSDAWNTFDSLIVIGSIVDVVLSEA
DPKPTETVTTDESGNSEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALP
YVALLIAMLFFIYAVIGMQVFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEI
MLACLPGKRCDPESDYNPGEEYTCGSNFAIIYFISFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIG
PEIRRAISCDLQDDEPEENNPDEEEEVYKRNGALFGNHINHISSDRRDSFQQINTTHRPL
HVQRPSIPSASDTEKNIYPHTGNSVYHNHHNHNSVGKQVPNSTNANLNNANVSKVVHGKH
ANFGSHEHRSENGYHSYSRADHEKRRRPSSRRTRYYETYIRSDSGDGRRPTICREERDIR
DYCNDDHYLGEQEYYSGEEYYEEDSMLSGNRHVYDYHCRHHCHDSDFERPKGYHHPHGFF
EEDDSQTCYDTKRSPRRRLLPPTPASNRRSSFNFECLRRQSSQDDIPLSPNFHHRTALPL
HLMQQQVMAVAGLDSSKAHKHSPSRSTRSWATPPATPPNRDHTPYYTPLIQVDRAESTEH
MNGSLPSLHRSSWYTDDPDISYRTFTPANLTVPNDFRHKHSDKQRSADSLVEAVLISEGL
GRYAKDPKFVSATKHEIADACDMTIDEMESAASNLLNGNISNGTNGDMFPILSRQDYELQ
DFGPGYSDEEPEPGRYEEDLADEMICITSL
NT seq 6573 nt   +upstreamnt  +downstreamnt
atgcagcaccaccagcagcagcagcccgagcagcacccagaagaggcgaactatgcaagc
agcaccagaattcctctccctggtgacggaccaactactcagtccaacagttcagcacca
tccaagcaaactgttctgtcttggcaagctgcaattgatgctgctagacaagcaaaggct
gcccaaaatatgaataccaccacagcccagcctgtaggatctctgtcccaaagaaaacgc
cagcaatatgccaagagcaaaaaacagggtaatacgtctaatagtcggccaccccgtgcc
cttttctgtttatccctcaacaacccaatacgaagagcctgcattagtctagtagaatgg
aaaccatttgacatatttatactactgtctatttttgccaattgtgtggccttagctgtt
tacatcccattcccagaagatgattctaattcaactaatcataacttggaaaaagtagaa
tatgccttcctgataatttttacagttgaaacatttttgaagattatagcatatggatta
ttattacaccccaatgcgtatgttagaaatggatggaatttattggattttgtaatagta
gtagtaggattatttagtgtaatattggaacaattaaccaaagaaacagaaggtggcagc
cactcaggtggcaaacctggaggctttgatgtcaaagccctaagagcctttcgtgtattg
cgacctctccggcttgtatcaggagtgcccagtttacaagttgtcctgaactccattata
aaagccatggttcccctgctccatattgcccttttggtattgtttgtaatcataatctat
gctattataggattggaactttttattggaaaaatgcacaaatcttgttttcttattgat
tcagatatactagttgaagaagatccagcaccttgtgcattctcagggaatggacgtcag
tgtgtcatgaatggcactgaatgtaagggtggttgggttggaccgaatggaggcataacg
aacttcgataattttgcatttgcaatgctgactgtattccagtgtataaccatggaagga
tggactgatgtgttatactgggtaaatgatgcaataggatgtgaatggccatggatctat
tttgttagtcttatcatccttggctcatttttcgtacttaacctggttcttggtgtactt
agtggggaattttccaaggaaagagaaaaagccaaggcccgaggggactttcagaagcta
cgtgaaaaacaacagcttgaagaagatctgaagggatatttagactggattacacaggca
gaagacattgatcctgagaatgatgaagaggctgatgaagaagggaaacggaacagggtt
acactggctgacttaatggaagaaaagaagaaaagcagacttagttgctttggccggtct
tccaataaacatgcaagcatgcccaccagcgaaaccgagtcagtgaacacagagaatgtg
agtggagaaggagagaacccagcatgctgtgggagcttatgtcaaaccatctcaaaatcc
aagttcagtcgacgctggcgtcgctggaatcgatttaatcgaagaaaatgtagagctgca
gtaaaatctgtcacgttttattggcttgttattgtcttggtctttctgaacacattaact
atctcatcggaacattataaccaacctgactggctgacccagatccaagatatcgcaaat
aaagttcttctggctttgttcacctgtgaaatgttagtaaagatgtacagcttgggtcta
caggcttattttgtttctctttttaaccgctttgattgcttcgttgtttgtggtggcatt
gttgaaaccattttggtggagttggaaattatgtcaccccttggaatttcagtgtttcgc
tgtgttcgtctcctgcgtatttttaaagtaacaaggcactgggcatccctgagcaacttg
gtagcatccttgttaaactcaatgaagtccattgcttcactgttgcttctgcttttcctc
ttcatcataatcttctcgttgcttggaatgcagctgtttggaggcaaatttaattttgat
gaaactcaaacaaaacggagcaccttcgataattttccacaagctcttttaactgtattc
cagattctaacaggtgaagactggaatgctgttatgtatgatggcataatggcgtatggt
ggcccatcatcgtcaggcatgatagtctgcatatatttcattatcctcttcatctgcggt
aactatatcttgctaaatgtcttcttggccattgctgtggataacttggcagatgctgaa
agtctaaatacagctcagaaagaagaagcagaagaaaaggaaaggaaaaagaatgcaaga
aaagaaagtctggaaaataaaaaaagtgagaagtcagaaggtgaccaaaagaagcccaag
gatagtaaggtgacaattgctgaatatggagaaggagaggatgaagataaagatccctat
ccaccctgtgatgtaccagtaggtgaagatgaagaagatgaggaggatgaacctgaggta
ccagcaggcccacgtccccggagaatatcagaactaaacatgaaggagaagataacaccg
atccctgaagggagtgccttcttcattttcagcagcaccaatccaattcgagtgggatgc
cacaggctcatcaatcaccacatctttaccaatctcatccttgtcttcatcatgctgagc
agtgtttccctagcagcagaagatccgattcgcagccactcttttcgaaataatatccta
gggtatgcagattatgtcttcactagtatgtttacatttgagatcattttgaagatgaca
gctttcggagcattccttcataaagggtccttctgcagaaattactttaatttgctggat
ttgctggttgtgggtgtttctctggtatcatttggtattcagtcaagtgctatctcagtt
gtgaagatcctcagagttttgagagtcttgaggccccttagggctataaacagagcaaaa
ggacttaagcacgttgttcagtgcgtctttgtggctattagaactattggtaatatcatg
attgttacaactctgctgcagttcatgtttgcttgtattggagtgcagctcttcaaggga
aaattctacaagtgcactgatgaggcaaaacagaatccagaggaatgccgggggatatac
attgtttataaagatggagatgttgataatccaatggtcaaagagagggtctggcaaaat
agtgatttcaacttcgacaatgttctgtctgctatgatggcccttttcacagtgtctact
tttgaaggctggccagcgctgctgtacaaagccattgattccaatggcgagaatgtagga
cctgtgtacaactacagagtggagatctccatttttttcatcatctacatcatcattatt
gctttctttatgatgaacatatttgttggttttgtcattgttacctttcaagaacaggga
gaacaagaatacaagaactgtgagctggacaaaaatcagcgtcagtgcgtggaatatgcc
ttgaaggctcgtcctcttcgtagatacattccaaaaaatccttaccagtataagttctgg
tatgtggtgaattctactggatttgaatacatcatgtttgtcctcatcatgctgaacaca
ctttgcctggctatgcagcactatggacagtctaagctctttaatgatgcgatggacatt
atgaatatggttttcacgggagtgttcactgttgaaatggttttgaagctgattgcattc
aaacccaagatttttgtaagaaaaaaggaaagatggctaggctattttagtgatgcctgg
aatacgtttgactccctcatcgttattggcagcatagtagacgtcgttctcagtgaagct
gatccaaagccaactgaaacagtcacaactgatgagtctgggaactccgaagacagcgca
agaatctccatcacttttttccgtcttttccgagtgatgaggttggtgaagctgcttagc
agaggagaaggaatcagaactttattgtggacatttattaagtcatttcaggctctgcct
tatgttgcccttctgatagctatgctgttcttcatctatgctgtcattggaatgcaggta
tttggaaaagtggccatgagagacaacaatcaaataaacagaaacaacaattttcaaact
ttcccccaagctgtgctgcttctcttcaggtgtgcaactggagaagcctggcaggaaatc
atgctggcatgtttgcctggaaaacgctgtgatccagaatctgattataatccaggggaa
gaatacacatgtggaagcaattttgccatcatttattttatcagtttttatatgctttgt
gcatttttgataataaacttatttgtggctgtcattatggataactttgactatttgaca
cgtgactggtccattctgggtcctcatcatttggatgagttcaaaaggatatggtcagaa
tatgaccctgaagcaaagggaaggataaagcatcttgatgtggttacgttactgagacgc
attcagccaccacttggttttggcaaattatgccctcaccgggtggcctgcaagaggtta
gtggccatgaatatgccactaaatagtgacggaaccgtcatgttcaatgctactttgttt
gctttggttaggactgctctaaagataaaaacagaaggtaacctagagcaagcaaatgaa
gaacttagagcagttataaagaaaatatggaagaaaactagcatgaaattacttgaccaa
gttgtccctccggctggcgatgatgaggtaaccgtggggaagttctatgccaccttcctg
atacaggactactttaggaaattcaagaaacgcaaagaacaaggactggtggggaaatat
cctgcgaagaataccacgattgctctgcaggcaggactaaggacacttcatgatattggc
cctgaaatacgccgagctatatcctgtgacttgcaagatgatgaaccagaggaaaacaat
ccagacgaggaggaggaagtttataaaaggaatggtgccctctttggcaaccatataaac
catattagcagtgacagacgagattcatttcagcagatcaacaccacgcaccgtccctta
catgtgcagcggccttcaattccatctgcaagtgatactgagaaaaatatatatcctcat
acaggaaattctgtgtaccacaatcatcataaccacaactcagtaggaaaacaagttcca
aactcaacaaatgccaatctcaataatgccaacgtatccaaagttgttcacggaaaacac
gctaattttggaagtcacgagcatagatctgaaaatggttaccattcgtactctagagct
gaccatgagaagcgtagaaggccaagcagtaggagaacccgctactacgaaacatatatt
aggtctgactctggtgatggccgtcgaccaactatttgccgtgaagaacgtgacattcga
gactattgcaatgatgatcattatttgggagagcaggaatattatagtggagaagaatac
tatgaggaagacagcatgttgtcaggaaacagacatgtgtatgattaccactgtagacat
cactgccatgactcagattttgagagaccaaaaggttaccatcacccacatgggtttttt
gaggaagatgattcacagacctgttatgatacgaaaagatctcctaggagacggctgcta
cctccaacaccagcatcaaatagacgatcttcctttaattttgaatgcctccgccgacag
agtagtcaagatgatataccactctctccaaatttccatcatcgcactgctttaccactt
cacctaatgcaacagcaggtcatggctgttgcaggtctggattccagtaaagctcataaa
cattcaccaagtcgttccacgcgttcatgggctaccccacctgcaacccctcccaacagg
gaccataccccatactatacacctctaatccaagttgacagggctgaatctacagaacat
atgaatggtagcctgccttccttgcacaggagctcctggtacacagacgaccctgatatc
tcctaccgaacatttacaccagccaatttaacagtacctaatgactttaggcataaacac
agtgacaaacagaggagtgcagacagtttggtagaagcggtacttatatctgaaggccta
ggaaggtatgcaaaggaccctaaatttgtttcagctacaaaacatgagattgctgatgct
tgtgacatgactatcgatgagatggaaagtgcagcaagtaatcttctcaatggaaatatt
agcaatgggaccaatggggatatgtttcccattttaagcagacaagattatgaacttcaa
gattttggtcctggctacagtgatgaagaaccagaaccaggacgatatgaagaagactta
gctgatgaaatgatatgcattacaagcttatag

KEGG   Gallus gallus (chicken): 395985
Entry
395985            CDS       T01006                                 

Gene name
CATSPER2
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1S isoform 1
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395985 (CATSPER2)
   04020 Calcium signaling pathway
    395985 (CATSPER2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395985 (CATSPER2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395985 (CATSPER2)
   04261 Adrenergic signaling in cardiomyocytes
    395985 (CATSPER2)
   04270 Vascular smooth muscle contraction
    395985 (CATSPER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395985 (CATSPER2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   395985 (CATSPER2)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C DUF2670
Other DBs
NCBI-GeneID: 395985
NCBI-ProteinID: NP_001292076
CGNC: 49591
Ensembl: ENSGALG00000037744
Position
26
AA seq 1836 aa
MEPASHQDDVKKRQQKEKSKKPVPPVAPRPPRALFCLTLQNPLRKACISIVEWKPFEIII
LLTIFANCVALAIYQPMPEDDTNVANSSLEKLEYVFLIFFAIEAMLKIIAYGFLFHTDAY
LRNGWNVLDFSIVSLGLVTMTLEQINAKEGGSLGGKGGFDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGQELFKGKMHKTCYYLGTDVIATVGSE
KPAPCTTSGHGRHCSINGTECRGGWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYW
VNDAIGNEWPWIYFVSLILLGSFFVLNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE
EDMKGYMDWITHAEVMDSDRARGEGMMPLDEGGSETESLYEIEGMNKWILYFRQWRRWNR
MFRRKCRDVVKSKFFYWLVILLVALNTLSIASEHHFQPEWLTIVQDNANRVLLALFVAEM
LLKMYALGLRQYFMSLFNRFDCFVVCAGVLEIILVELSTLSPLGISVLRCIRLLRIFKIT
RYWTSLSNLVASLLNSVRSIASLLLLLFLFIIVFALLGMQLFGGMYDFEDMEVRRSTFDN
FPQALISVFQILTGEDWNSIMYNGIMAYGGPSFPGMLVCIYFIILFVCGNYILLNVFLAI
AVDNLAEAESLTSAQKAKAEERKRRKMSRGYPEKSEDEKQMLAKKLEQKAKGEGIPTTAK
LKVDEFESNVNEIKDPYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAVPMPEASSF
FIFSPTNKFRMLCHRIVNATWFTNFILLFILLSSISLAAEDPIRAESFRNQILGYFDIGF
TSVFTVEIVLKMTAYGAFLHKGSFCRNSFNILDLLVVAVSLISMGFESSTISVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVVVTTLLQFMFACIGVQLFKGKFYSCTD
PSKLTEKECRGHFINYVDGDPTQIELKERVWFHNAFHFNNVLSAMMSLFTVSTFEGWPEL
LYRAIDTNDENKGPIYNYRVEIAMFFIIYIILIAFFMMNIFVGFVIVTFQEQGESEYKNC
ELDKNQRQCVQYALKARPLRRYIPKNPYQYQIWYVVTSSYFEYLMFFLIMLNTICLGMQH
YNQSAEMNHVSDILNVAFTVLFTLEMILKLMAFKAKGYFGDPWNVFDFLIVIGSIIDVIL
SEIDTVLASSGGLYCLGGGCDSIDPDDNSRVSITFFRLFRVMRLVKLLSRGEGVRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRC
ATGEAWQEILLDCSYGKRCDPESDYAEGEEYTCGTGFAYFYFISFYMLCAFLIINLFVAV
IMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFC
PHRVACKRLVCMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRTIIKKIWK
RTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKNPVEIQAGL
RSIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIYRRTGGLFGQVDSFLEPSSPLQ
PHVASQRPLQFTEVGSEDLDSPVFLDDFPQEGNTNVNNANWQQGLEYEDEVLRRAVPRPP
VREPDLPIPLERLRRRRGAASEHHPASGPSLHPQQGSTVTAAASSSEHRWHESIDTNTSS
TPAITFLIQEALISGGLAALARDPSFVAVTRDEMAASSQMEMDEVEKAAVELLQGREALQ
DTEISSAPRDTLAASAVSTPGLSVAASHQTSSAARL
NT seq 5511 nt   +upstreamnt  +downstreamnt
atggagcctgcgtcccaccaggatgatgtgaagaagaggcaacagaaggagaaatccaag
aagccggtgccaccagtagcccctcggccacccagggctctgttctgcttaaccctacag
aacccactgcggaaggcatgcatcagcatcgtggagtggaaacctttcgagatcatcatc
cttctgaccatctttgccaactgtgttgccctggccatctaccagcccatgccggaggat
gacaccaacgtggccaactccagcctggagaagttggaatatgtcttcctgatcttcttt
gccatcgaggccatgctcaagataatagcttacgggtttctgttccatacggacgcctat
ctccgaaacggctggaacgtcctcgacttctccatcgtttccctggggcttgtcaccatg
accctggagcagatcaatgcaaaggagggagggtctttgggagggaaaggtggctttgat
gtgaaggccctgcgagcgtttcgtgtgctgagacctctgcgcctggtgtccggagtgcca
agtcttcaggttgtcctgaactccattatcaaagccatggtgcctctgctccacattgca
ctgctcgtcctcttcatgatcatcatctatgccatcgtggggcaagagctcttcaagggc
aagatgcacaagacctgctactaccttgggacagatgtgatcgccacggtggggtcagag
aagccagccccctgcacaacctctggccatgggcgtcactgctccatcaatggcactgag
tgccgtggtggctggccgggacccaacaatggcatcactcacttcgataactttggcttt
gccatgctgactgtctaccagtgcatcaccatggagggctggaccgaagtgctctactgg
gttaacgatgccattggaaatgaatggccatggatctactttgtcagccttattttgctt
ggttccttctttgttctcaacctggtgctgggggtgctcagtggggagttcaccaaagag
cgtgagaaggccaagtcacgaggcacgtttcagaagctgcgggagaagcagcagctggag
gaggatatgaagggctacatggactggatcacccatgctgaggtgatggacagtgaccgg
gccagaggagaaggtatgatgccgttggatgaaggagggtcagagacagagagcttgtat
gaaattgagggcatgaacaaatggattctctacttccggcagtggaggcgttggaaccga
atgtttcgtaggaagtgcagggatgtggtgaaatccaagttcttctactggctggtcatc
ctgctggtggcactgaataccctctccatcgcctctgagcaccatttccagcccgaatgg
ctgacgattgtacaagataatgccaaccgggtgctgcttgctctctttgtggccgaaatg
ctgctgaagatgtatgcactgggcctgcgccagtacttcatgtccctcttcaaccgcttc
gactgctttgttgtgtgtgcgggggtcctggagatcatcctggtggagctcagcacgttg
tcacccctgggcatctctgtgctgcgctgcatccggctgctccgcatcttcaagatcacc
aggtattggacatcactgagtaacctggtggcctctctgctcaactcggtgcgctccatt
gcctctctgctccttctcctcttcctcttcatcattgtttttgccctactgggcatgcag
ctctttgggggcatgtatgacttcgaggacatggaggtgcgacgcagcacattcgacaac
ttcccccaggccctcatcagtgtcttccagatcctgactggagaggactggaattcaata
atgtacaatgggataatggcttatgggggcccatccttccctggcatgctggtctgcatc
tacttcatcatcctctttgtctgtgggaactatatcctcctcaacgtcttcctggccatt
gcagttgataatctggctgaggctgagagcctgacctcagctcagaaggccaaagctgag
gaacgcaagcggcggaagatgtccagaggttacccagagaagtctgaagatgaaaagcag
atgttggcaaagaagcttgagcagaaagcgaagggagaaggaattcccacaacagccaag
ttaaaagtggatgaatttgaatccaatgtcaatgagatcaaagatccctacccatccgca
gacttcccaggtgatgatgaggaggatgagcctgaaatccccctgagtcctcggccacgt
cctctggcagagctgcagctgaaagagaaggctgtgcctatgcctgaagccagctccttc
ttcatcttcagcccaacgaataagtttcggatgctgtgccacagaatcgtcaacgccact
tggttcaccaacttcatcctgctcttcatcttgctcagcagcatttccctggcagctgag
gatcccatccgagccgagtcattccgcaaccagattcttggatactttgacatcggtttc
acttctgtcttcactgttgaaatcgtcttgaagatgacagcatatggtgctttcctgcac
aaaggctccttctgcaggaactcgttcaacatcctcgacttgctggtggttgctgtgtct
ctcatctccatgggatttgagtccagcacaatctcagtggtgaagatcctccgggtgctg
agggtgctgaggcctctgcgagccattaacagggcaaaggggctgaagcacgtggttcag
tgtgtgttcgtggccatcaagaccattggtaacattgtggtcgttacgacgttgctgcag
ttcatgtttgcctgcattggggtgcagctcttcaagggcaagttttacagctgcacagat
ccctccaagctaacagagaaggagtgtagggggcatttcatcaactacgtggatggggac
ccaacgcagatcgagctgaaggagcgggtctggttccacaacgcctttcacttcaacaat
gtcctctcagccatgatgtcgcttttcactgtttccaccttcgagggctggccagagctg
ctgtacagggccattgacactaacgatgagaataaaggccctatctacaactaccgggtg
gagatcgcgatgttcttcatcatctacatcatcctcattgccttcttcatgatgaacatc
tttgtgggctttgtcattgtcaccttccaggagcagggggagagcgagtacaagaactgt
gagctggacaagaaccagcgccagtgtgtgcagtacgcactgaaggctcgcccgctgcgg
cggtacatccccaagaacccctaccaataccagatctggtacgtggtcacctcctcctac
ttcgagtacctcatgttcttcctgatcatgctgaacaccatctgcctgggcatgcagcat
tacaaccagtctgcggaaatgaaccacgtctcagacatcctcaatgtggccttcaccgtc
ctcttcaccctggagatgatcctcaagctcatggcctttaaagccaagggctactttggg
gacccctggaatgtcttcgacttcctcatagtgattggcagcatcattgatgtcattctc
agcgagattgatactgttcttgcatccagtggtggattgtactgcctcggcggaggttgt
gatagcattgacccggatgacaactcccgtgtctccatcacgttcttccggctgttccga
gtgatgcggctggtgaagctgctgagccggggagaaggcgtcaggaccctcctgtggacc
ttcatcaaatccttccaggctctgccctatgttgccctgctgatcgtgatgctgttcttc
atctatgctgtgatcgggatgcagatgtttgggaagattgccatggtggacggaacccag
atcaaccgaaacaacaacttccaaaccttcccacaagctgtgctgctgctcttcaggtgt
gccacgggggaggcctggcaggagatcctgctggactgcagctatgggaagcggtgcgac
cctgagtctgactacgcggagggcgaggagtacacctgtggcacgggctttgcctacttc
tatttcatcagcttctacatgctctgtgcctttctgatcattaacctttttgtggctgtc
atcatggacaactttgactacctcacacgtgactggtccatcctggggccccaccacctg
gatgagttcaaacggatctgggctgagtacgaccctgaagccaagggcaggattaagcac
ttggatgtggtgaccctgctgagacgtatccaacctcccctgggctttgggaagttctgc
cctcaccgtgtagcttgtaagcgcctggtgtgcatgaacatgcccctgaacagcgatggc
actgtcaccttcaatgcaaccctctttgcgctggtgaggacagccctcaaaatcaagaca
gaaggtaactttgaacaggccaatgaggagctcagaaccattatcaaaaaaatctggaag
cgaaccagtatgaagcttttggaccaggtcatcccacctattggagatgatgaggtgaca
gtgggcaaattctatgctactttcctcatccaagagcatttccgaaagttcatgaagcgc
caggaggagtactatgggtaccgtcccaagaagaaccctgtagagatccaggctgggctg
agaagcattgaagaagaagctgctcctgaaattcatcgagccatctctggggacctgact
gctgaggaggagctggagagggcaatggtggaagctgccatggaggaggggatatacagg
aggacgggaggtttgtttggccaggtggacagcttcctggagccgagcagccccctgcag
ccccacgtggccagccagaggcccctgcagttcacagaggtgggcagcgaagacctcgat
tcccccgtcttcctcgacgacttcccccaggaaggcaacaccaatgtcaacaacgccaac
tggcagcaggggttggaatacgaggatgaggtgctgaggagagcagtgcccaggcctcca
gtgcgggagcctgacctccccatccctttggagaggctgcggcggaggcgaggagctgcc
tctgagcatcacccagcatcggggccatccctccatccccagcagggcagcacagtgaca
gcagcagcatccagctcagaacaccgctggcatgaaagcattgacacaaacacatcttct
acccccgccatcaccttcctcattcaagaggctctgatctccggaggcctcgctgctctg
gcccgcgacccatcctttgttgcagtgaccagggatgagatggcagccagcagccagatg
gagatggacgaagtggagaaagctgcagtggagctgctacagggaagagaagcactgcag
gacacagaaatcagctctgctccccgggacaccttggctgcatcagcagtcagcaccccg
gggctcagcgtggccgcatcccatcagaccagctctgctgctcgcctgtga

KEGG   Gallus gallus (chicken): 415996
Entry
415996            CDS       T01006                                 

Gene name
CACNA2D3
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3 isoform X2
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    415996 (CACNA2D3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    415996 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    415996 (CACNA2D3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    415996 (CACNA2D3)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   415996 (CACNA2D3)
SSDB
Motif
Pfam: VWA_N VGCC_alpha2 VWA_3 VWA VWA_2 dCache_1 dCache_2 Cache_3-Cache_2 VWA_CoxE
Other DBs
NCBI-GeneID: 415996
NCBI-ProteinID: XP_015148891
CGNC: 4020
Ensembl: ENSGALG00000005400
Position
12
AA seq 1084 aa
MLENLNLLRASGFFFFIFWTAFNTALVDVVGSEQQIPLSVVKLWASAFGGEIKSIAAKYS
GSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEDAYLKHE
FDADLQYEYFNAVLINERDEEGNYLELGKEFILVPNDHFNNLPVNISLSDVQVPTNMYNK
DPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDC
RNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEL
HYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNMLNEFNHTGQGSIC
SQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQI
STLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLADDQGLVLMTTVAMPVFSKQ
NETRSKGILLGVVGTDVPVKELLKAIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGK
KRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYT
DIKGTPFSLGVALSRGHGKYFFRGNVTVEEGLHDLEHPDVSLADEWSYCNTDLHPEHRQM
TQLEAIKRYLTGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAF
LGTRTGLSRINLFVGPEQLTNQDFLTAEDKENIFNADHFPLWYRRAAEQIPGSFVYSIPF
STETANKSNVVTASTAIQLLDDRKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGRCAI
SCDDEAINCYLIDNNGFILVSEDYGQTGNFFGEVEGAVMNKLLTMGSFKRITLYDYQAMC
RTNKESSDSAHSLLDPYNAFFAAVKWIMTELVLFLVEFNLCSWWHSDLTAKAQRLKQTLE
PCDTEYPAFVSERTIKETTGNIACDDCFKSFVIQQIPSSNLFMVVVDNECFCDSVPPITM
APIEIRYNESLKCERLKSQKIRRRPESCHGFHPEENARECGGVPGLSAKPPFVLLPLILT
IFSR
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgctagaaaatctgaatcttcttcgggcttctgggttttttttctttatcttctggaca
gcttttaacacagccttagtggatgtggttggatcggagcagcagatccccctgtctgtt
gtgaagctctgggcctcagcgtttggtggggagatcaaatctattgcagccaagtactcg
ggttcccagctcctgcagaagaaatacaaagaatatgagaaagacgttgcaatagaagaa
attgatggccttcagcttgtgaaaaagttagcgaagaatatggaagaaatgtttcataag
aagtccgaagctgtgcggcgtcttgttgaggctgcagaagatgcttatctgaaacatgag
tttgatgctgatttgcagtatgagtacttcaatgctgtgcttataaatgaaagagatgaa
gaagggaactatctggagctgggaaaggagttcattctagtgccgaacgaccacttcaat
aacttgcctgtaaatatcagtctgagtgatgtccaagtaccaactaatatgtataataaa
gatccagccattgtaaatggagtttattggtcagaatccttaaataaggtgtttgttgat
aactttgatcgtgacccttctctcatctggcagtactttggaagcgcaaaaggatttttc
agacagtatccaggaattaaatgggaacctgatgagaatggagtcattgcatttgactgc
agaaatagaaaatggtacatccaagcagcaacttctccaaaagatgtggtaattttagta
gatgtcagtggcagtatgaaaggacttcgcttgactattgctaagcagacagtttcatct
attttggatacccttggagatgatgacttcttcaatataattgcttataatgaagaactt
cactatgtagaaccgtgtctgaacggaacattggttcaagcagacagaaccaacaaagag
cattttagggaacaccttgacaagctttttgcaaaaggaattggaatgctggacattgct
ttaaatgaagctttcaacatgctcaatgaattcaatcacacaggacaaggaagtatttgc
agccaagccataatgttgattactgatggagctgtggacacatatgacacaatatttgca
aaatataattggccagacagaaaagttcgtattttcacctatctgattggaagagaagct
gcttttgctgacaacttgaaatggatggcctgtgctaacaaagggttttttactcagatc
tctaccttagctgatgttcaagagaatgtcatggaatatctccatgttcttagccgacca
aaagttattgaccaagagcatgacgtggtatggactgaagcatatattgacagcactctt
gctgacgatcagggattggtgttgatgacaactgttgccatgccggtatttagtaagcaa
aatgagactagatcaaaagggattctcctgggagtagttggcacagacgtcccagttaaa
gaacttctaaaagctattccaaaatacaagttaggtattcatggatatgcttttgcaatt
acaaacaatggatatattttgactcatccagaacttaggcctttgtatgaagaaggaaag
aaacgaagaaagcccaactacagtagtgtggatctttctgaggttgagtgggaagacaga
gatgatgtgcttcgaaatgcaatggtgaatcgtaaaacaggaaaattctccatggaagtg
aagaaaacagtggacaaagggaaacgggtattggtgatgacaaatgactactattataca
gacatcaagggtactccattcagtttaggtgtggctctctctagaggacatggaaaatat
ttcttcagagggaatgtaactgtggaagaaggtttacatgatttagaacaccctgatgta
tctttagcagatgaatggtcctactgcaacactgacttgcatcctgaacaccgtcaaatg
actcagttagaagcaattaaacgctacctcacaggaaaagagccattgctccaatgtgat
aaagaattgatccaggaagttctgtttgatgcagtggtgagtgcaccaattgaagcttat
tggaccagtttagcactaaataaatcagaaaattctgacaagggagttgaagttgccttc
cttggaacacggaccggattatctcgtatcaacctgtttgtgggtccagaacagcttact
aatcaagatttcctgacagctgaagacaaggaaaacatttttaatgctgatcattttcca
ctctggtatagaagagctgctgagcaaatacccgggagctttgtctattcaattccattt
agtacagaaacagcaaacaaaagcaatgtagtgacagccagtactgccattcaacttttg
gatgacagaaaatctccagtcgttgcagctgtaggtatccagatgaaacttgaatttttc
cagcggaaattttggacagcgagcagacagtgtgcgtctcttgatggcagatgtgcaata
agttgtgatgatgaagcaatcaactgttacctaatagacaacaatggatttatcctagtg
tctgaagactatgggcagactggtaacttttttggggaggttgaaggggctgtgatgaac
aaattgctaacaatgggctcctttaagagaattacactttatgactaccaggccatgtgt
agaacaaacaaagagagtagcgacagtgcccatagcttactggacccttataatgccttc
tttgctgcagtaaaatggattatgacagagcttgtcttgttccttgtggagtttaatctg
tgcagttggtggcactctgatctaacagcaaaagcgcagaggttgaaacaaaccctagag
ccctgtgatactgaatatccagcttttgtttccgaacgcactataaaggagactacgggg
aatattgcttgcgatgactgtttcaagtcctttgtaatccagcaaatcccaagcagcaat
ctctttatggtggtagtagataatgaatgcttctgtgattctgtcccacccattaccatg
gcacctatagaaataagatataatgaatcccttaaatgtgaacgtttaaaatctcagaag
ataagaagacgcccagaatcttgccatggatttcaccctgaagaaaatgcaagagaatgt
ggtggtgtcccaggtcttagtgctaagcctccttttgttcttcttcctctgatattgaca
attttctcaaggtga

KEGG   Gallus gallus (chicken): 417428
Entry
417428            CDS       T01006                                 

Gene name
CACNG1
Definition
(RefSeq) voltage-dependent calcium channel gamma-1 subunit
  KO
K04866  voltage-dependent calcium channel gamma-1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    417428 (CACNG1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    417428 (CACNG1)
   04261 Adrenergic signaling in cardiomyocytes
    417428 (CACNG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    417428 (CACNG1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   417428 (CACNG1)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin UNC-50 Clc-like IspA NicO LapA_dom DUF981
Other DBs
NCBI-GeneID: 417428
NCBI-ProteinID: NP_001264935
CGNC: 2856
Ensembl: ENSGALG00000027771
UniProt: F1NC88
Position
18
AA seq 226 aa
MDETKPLKVRLTFCVLLVGVSLLFAAVVTDHWAVLSPRVEDFNATCEAAHFGLWRLCTKR
IHVQKQSAKETGCGPISLPGAHNCSYFKHFTPGLSSEIFEVTTQKEYSISAAAIAIFSVG
FAIIGTICVLFSFQKKRDYLLKPASMFYTFAGLCIIISVEVMRQSVKRMIDSKDTVWMEY
SYSWSFACACSAFVLLFVFGIVLLLIALPRFPQNPWETCMDAEPEH
NT seq 681 nt   +upstreamnt  +downstreamnt
atggatgagaccaaacccctgaaggtgcggctcaccttctgcgtgctgctggtgggcgtc
tcgctgctcttcgcggccgtggtgacggaccactgggccgtgctgagccccagggtggag
gacttcaatgccacctgcgaggcggctcacttcgggctctggcggctctgcacgaagcgg
attcatgtgcagaagcaaagtgccaaagagacgggctgcgggcccatcagcctgcccgga
gctcacaactgctcctacttcaagcacttcactcccggactgagctcggagatatttgaa
gtcaccacccagaaagaatacagcatttcagctgcagccattgccatcttcagcgttggc
tttgcaatcatcggaacaatctgcgtcctcttctccttccagaagaagagggactacctg
ctgaagccagcatccatgttctacacctttgcaggtctctgcatcatcatctccgtggaa
gtcatgagacagtctgtgaaaaggatgatcgacagcaaggacacagtctggatggagtac
agctactcctggtccttcgcctgtgcctgctctgccttcgtcctgctcttcgtctttgga
atcgtgctcctcctcatcgcgctgccccgcttcccccagaacccctgggagacctgcatg
gatgcagaacccgagcactga

KEGG   Gallus gallus (chicken): 417429
Entry
417429            CDS       T01006                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    417429 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    417429 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    417429 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    417429 (CACNG5)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   417429 (CACNG5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DUF6336 DHHC
Other DBs
NCBI-GeneID: 417429
NCBI-ProteinID: XP_015135443
CGNC: 2865
Ensembl: ENSGALG00000003911
UniProt: E1C4A6
Position
18
AA seq 279 aa
MLLGMSACSRKALTLLSSVFAVCGLGLLGISVSTDYWLYLEEGIVQPQNQSAEIKLSLHA
GLWRVCFLAGEERGRCFTIEYVMPMNIQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFI
LSNIGHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSETFFNYKYG
WSFAFSAISFLLTESAGVMSVYLFMKRYTAEDIYRPHPGFYRPRLSNCSDYSGQFLHPDA
WARGRSPSDISSEASLQMNSSYPALLKCPDYDQMSSSPC
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcttttggggatgagcgcctgcagcaggaaggcgctgaccctgctcagcagcgtgttc
gccgtctgcggcctcggcctgctgggcatctctgtcagcaccgactactggctctacctg
gaggaaggtatcgtccagccccagaaccagtcggctgaaatcaagctgtcgctgcacgca
gggctctggagggtctgcttcctggcaggtgaggaacgtggccggtgcttcactatagaa
tacgtcatgcccatgaacattcagctgacgtctgaatccacagtcaacgtcctgaagatg
atccgctctgccacccccttccctctggtcagcctcttcttcatgttcatcggcttcatc
ctgagcaacatcggccacgtgcggccgcacaggaccatcctcgccttcgtgtcggggata
ttcttcatcttgtcaggtctgtccctggtggtggggctggtcctctacatatccagcatt
aacgatgagatgctcaataggaccaaggactcggagacattcttcaattacaaatacggc
tggtcgttcgcattctctgccatctcgttccttctcacagagagcgctggggtgatgtcc
gtgtacctgttcatgaagcgatacaccgctgaggacatttacagacctcaccccggcttc
taccgtccccgtctgagcaactgctccgactactcggggcaattcctgcacccagacgca
tgggcgcggggccgcagcccttcagacatctccagtgaggcatctctgcagatgaacagc
agctacccggctctgctcaagtgccctgactacgaccagatgtcctcatccccgtgctga

KEGG   Gallus gallus (chicken): 427909
Entry
427909            CDS       T01006                                 

Gene name
CACNG2
Definition
(RefSeq) voltage-dependent calcium channel gamma-2 subunit isoform X2
  KO
K04867  voltage-dependent calcium channel gamma-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    427909 (CACNG2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    427909 (CACNG2)
   04261 Adrenergic signaling in cardiomyocytes
    427909 (CACNG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    427909 (CACNG2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   427909 (CACNG2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 CD20
Other DBs
NCBI-GeneID: 427909
NCBI-ProteinID: XP_004937832
CGNC: 66541
Ensembl: ENSGALG00000031977
Position
1
AA seq 300 aa
MTIAVGTDYWLYSRGVCKTKTVSENETSKKNEEVMTHSGLWRTCCLEGNFKGLCKQIDHF
PEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFV
SAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFID
RHKQLRANARATDYLQSSAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTL
PSTEISMYTLSRDPLKATTTPTATYNSDRDNSFLQVHNCIQKENKDSIHTNTANRRTTPV
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaccatagctgtggggaccgactactggctttactccagaggggtttgcaagactaaa
actgtcagtgagaacgaaaccagcaaaaagaacgaggaagtcatgacccattctggatta
tggagaacctgctgcctggaagggaattttaaaggtctgtgtaagcaaatcgatcacttc
cctgaggatgcagattatgaagccgatacagcagaatattttctccgggctgttagagcc
tctagtatttttccgatcctgagtgtgattctgcttttcatgggtggactctgcattgca
gccagcgagttctacaaaactcgacacaacatcatccttagtgccggcatcttcttcgtg
tccgcaggtctgagtaatataattgggatcatcgtatacatatcagccaacgctggagac
ccctcgaagagcgactccaagaagaacagctactcctacggctggtccttctactttggg
gccctgtccttcattatagccgagatggtgggagtgctggccgtccacatgttcattgac
cggcacaaacagctgcgcgccaacgctcgcgccacggactacctccagtcctccgccatc
acccgcatccccagctaccggtaccgctaccagagacgcagccgctccagctcccgctcc
accgagccttcacactccagggatgcctctcccgtcgggatcaaagggttcaacaccctc
ccatcaacagagatctcgatgtacaccctgagcagggacccgctgaaggccaccaccacc
cctactgctacctacaactccgacagggataacagcttcctccaggttcacaactgtatc
cagaaggagaacaaggactcgatccacaccaacacagccaaccgccggaccaccccggta
tga

KEGG   Gallus gallus (chicken): 428420
Entry
428420            CDS       T01006                                 

Gene name
CACNB2
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-2 isoform X1
  KO
K04863  voltage-dependent calcium channel beta-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    428420 (CACNB2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    428420 (CACNB2)
   04261 Adrenergic signaling in cardiomyocytes
    428420 (CACNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    428420 (CACNB2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   428420 (CACNB2)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1
Other DBs
NCBI-GeneID: 428420
NCBI-ProteinID: XP_015137497
CGNC: 6517
Ensembl: ENSGALG00000008591
Position
2
AA seq 648 aa
MVQSDMAKSPPSPAQEVPMELLDNPLPAAATQSYSKGARRKNRFKGSDGSTSSDTTSNSF
VRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVGYSAA
HDDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQ
KAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKP
SANSVTSPHSKEKRMPFFKKTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFL
KHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTL
QLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADK
LAQCPPEMFDVILDENQLEDACEHLADYLEAYWKATHPPSSNPPNQLLTRTLATATLPIS
PGPNINLQQGSQGDQRNDHSVPERSNSQIEEEARVEPIKKSHHRSSTQHHNHRSGVRGLP
RQETFDSETQDSRDSAYVEPKEDYSHEHGDHYDSHRDHNHRDESHGDHRHRESRHRSKER
DREQDHNECNKQRSRHKSRDQYCDKDGEVISKKRNDAGEWNRDVYIRQ
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggtccagagcgacatggccaaatcgcctcccagcccggcgcaggaggtgccgatggag
ctgctggacaaccccctgcccgcggcggcaacgcagtcttatagtaaaggggcaagaaga
aaaaatcggtttaaaggatcagatgggagtacatcttctgacactacctctaatagtttt
gtacgccagggctcggcggactcctacaccagccgtccatccgactccgatgtatctctg
gaagaagacagggaagcagtgcggagagaggcagagcgacaggcccaggcacagttggaa
aaagcaaagacaaaacctgttgcatttgcagttcggacaaatgtcggttatagtgcagct
catgatgatgatgttccagtcccaggcatggccatctcatttgaagctaaagattttctt
cacgttaaagaaaaatttaacaatgactggtggataggacggttggtaaaagaaggctgt
gaaataggattcataccaagcccagtcaaactagaaaacatgaggctgcagcatgaacag
aaggcaaagcaagggaaattctactccagtaaatcaggaggaaactcttcatccagtctg
ggtgacatagttcctagctccagaaaatcgacgcctccatcatctgctatagacatagat
gccactggcttagatgcagaagaaaatgatattccagcaaaccatcgctcccccaaaccc
agtgcaaacagtgtaacatcaccccactccaaagagaaaagaatgcccttctttaagaag
acagagcacatccctccctatgatgtagtgccttctatgagacctgtagttttagtggga
ccttctttgaagggatatgaggtaacagatatgatgcaaaaagcattatttgatttttta
aaacatagattcgaagggcgtatatcaattacaagagtcacagcagacatctcgcttgcc
aaacgctcagtattaaacaaccccagtaagcatgcgataatagagcgatccaacacaaga
tcaagcttagctgaagttcagagtgaaattgaacggatttttgaattagcaaggacactg
cagttggtagtgctcgatgctgacaccataaatcacccagcgcagctgagcaaaacctct
ctggcacccattatagtatacgtaaagatttcttctcctaaggttttacagaggttaata
aaatctcgagggaaatctcaggccaaacaccttaatgttcagatggtggcagctgataaa
ctggcacagtgtcctcccgaaatgttcgatgtaattcttgatgagaaccagctggaagat
gcttgtgagcaccttgctgactatctggaagcctactggaaggccacacatccgcctagc
agcaatcctcctaaccagcttctcactcggacacttgcaacagccactcttcctattagc
ccaggtccaaatattaacttacagcagggatctcaaggagaccagaggaatgaccactca
gtccctgaacgcagcaattcacaaattgaagaggaagcacgggttgaacccatcaagaaa
tcccaccatcgctcttcaacccaacaccataaccatcgcagtggtgttagaggccttcct
aggcaagaaacttttgactcagaaacacaagacagcagagattcggcttacgtagagcca
aaggaggactattcacatgagcacggtgaccactatgattctcacagggatcacaatcat
agagacgagtcccatggtgatcacagacatagagaatcaaggcatcggtcaaaggagagg
gaccgggagcaggaccacaatgaatgcaacaaacagcgaagtcgtcataaatcgagggac
caatattgtgataaggatggggaagtgatatctaaaaaacgtaacgacgcgggagaatgg
aacagggatgtttacatccgtcagtaa

KEGG   Gallus gallus (chicken): 430150
Entry
430150            CDS       T01006                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    430150 (CACNA2D2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    430150 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    430150 (CACNA2D2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    430150 (CACNA2D2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   430150 (CACNA2D2)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 VWA_CoxE
Other DBs
NCBI-GeneID: 430150
NCBI-ProteinID: XP_015148271
CGNC: 15287
Ensembl: ENSGALG00000038242
Position
12
AA seq 1126 aa
MAMAAPTGSAAPVAPALCGHLALLLLLAAPAAHGYSFPQQHTMQYWARRLEQEIDGVMRI
FGGVQQLRGIYNENRNLFEVKENVPRKLVEKVAGDIESLLAKKVRALKRLANAAEKFQKA
HHWQDNIREEDIEYYDSKADTEFVSAVSTDDPDGEEIEREKSNSLKLEFTDDANFKTKVN
YSYAAVQIPTDIYKGSTVILNELNWTQALEDVFIENRKEDPSLLWQVFGSATGVTRYYPA
TPWRAPNKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLS
DDDYVNVASFNEKAKPVSCFKHLVQANIRNKKVFKEDVQGMVAKGTTDYKAGFEYAFDQL
QNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNKTVRVFTFSVGQHNYDVTPLQWMA
CANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGNRAKQVQWTNVYQDALGLGLVVTGT
LPVFNLTEDNSDRKNQLILGVMGIDVALNDIKKLTPRYNLGANGYVFAIDLNGYVLLHPN
LQPQIINFREPVTLDFLDAELEDENKEEIRRSMIDGNDGQRFIKTLIKSLDEQYIDEVFR
TYTWAPIKSTNYSLGLVLPPYSTYYIQANLSDQILQVKLPNIKMKDFEYLLPNSFESEGH
VFIAPREYCKDLDLSDNNTEFLENFIALMEKVTPDSKQCDNFLLHNLILDTGITQQLVER
VWKDQDLNTYSLLAVFAATDGGITRVFPNKAADDWEEEPEPFNASFYRRSLDNKGYIFKP
PYRDDGYRGLDLENNTIGILVSTAVELSIGGKTLKPAVVGVKLDLEAWAEKFKVLASNRT
DRDQLGSRRCDPSSSCEMDCEANNKDLICVLIDDGGFLVLSNQEDHWYQVGKFFSEVDAN
LMSALYNNSFYARKESYDFQSVCAPEAQSNTGAAPRGVFVPTVADLLSLAWWTSAAAWSL
FQQFLYSLTYSSWFQTEDVMADGMEARETSCIMKQTQYYFSTVNATYNAIIDCGNCSRLF
HAQRLANTNLLFVVADKPLCSQCESVKLLQAEVRAPPRDPNQCELVDRPRYRKGPHICFD
YNATEDTSDCGRGASFTPSLGVLLSLQLLLLYASTSRHPLPPAACL
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggcgatggcggctccgaccggcagcgctgcgcccgtcgccccggcgctctgcggccac
ctggccctgctgctgctcctcgccgcccccgccgcgcacggctacagcttcccccagcag
cacactatgcagtactgggccagaaggctggagcaggagattgatggcgtgatgaggata
tttggtggcgtccagcagctcagagggatctacaatgagaacagaaacctgtttgaagtc
aaggagaacgtgcccagaaaattagtggagaaggttgcaggggacatcgagagcctgctg
gccaagaaagtccgtgctttaaagaggctggccaacgcagcagagaagttccagaaggcc
caccactggcaggacaacatccgggaggaggacatcgagtactacgactccaaggcggac
acggaattcgtgagtgctgtgagtactgatgatcccgatggggaagaaatcgagcgggag
aaatccaactcccttaagctggagttcaccgacgatgccaacttcaagaccaaggttaac
tactcatatgctgccgtgcagatccccactgacatctacaaaggctccaccgtgatcctc
aacgagctgaactggacgcaggcgctggaggacgtcttcattgagaaccgcaaggaagac
ccctccctgctctggcaggtcttcggcagcgccaccggcgtcacccgctactaccctgcc
accccatggagagcacccaataagatcgacctgtatgacgtgcgcagacggccctggtac
atccagggtgcttcgtccccaaaggacatggtcatcatcgtggatgtgagcggcagtgtg
agcggcctcaccctcaagctgatgaagacctcggtctgtgagatgctggacacgctctcg
gatgatgactacgtcaacgtggcctcgttcaacgagaaggcaaagccggtgtcatgcttc
aagcacctggtgcaggccaacatccgcaacaagaaggtcttcaaggaggatgtgcagggc
atggtggccaagggcacgactgactacaaggctggctttgagtatgccttcgaccagctg
cagaattccaacatcacacgtgccaactgcaacaagatgatcatgatgttcacagacggt
ggtgaggaccgggtgcaggacgtctttgagaagtacaactggcccaataagacggtgcgt
gtctttaccttctccgtggggcagcacaactatgacgtgaccccactgcagtggatggca
tgcgccaacaaaggttactacttcgaaatcccctctatcggcgccatccgcatcaacaca
caggagtacctggatgtgctgggcaggcccatggtgctggctgggaaccgtgccaagcag
gtgcagtggaccaacgtctaccaggatgcgctggggctggggctggtggtgacaggcacg
ctgcccgtgttcaacctgacagaggacaacagtgacaggaagaaccagctcatcctgggt
gtgatggggatcgacgtggcgctgaacgacatcaagaagctgacaccacgatacaatctg
ggcgccaatggctacgtcttcgccattgacttgaatggctacgtgctgctgcaccccaac
ctgcagccccagatcatcaatttccgtgagccggtgacgctggacttcctggacgccgag
ctggaggacgagaacaaggaggagatccggagaagcatgattgatgggaacgatgggcag
aggttcatcaagacacttatcaagtcgctggacgagcaatacatcgacgaggtgttcagg
acctacacgtgggctcccatcaaaagcaccaactacagcctggggctggtcctgcccccc
tacagcacctactacatccaggccaacctcagtgaccagatcctgcaagtgaagttacca
aacatcaaaatgaaggattttgaatacctgctgcccaacagctttgagtcggagggacat
gtgttcattgctcccagagagtattgcaaagacctcgacttgtcagataacaacaccgag
ttcctggagaactttattgccctcatggaaaaggtgaccccagactccaagcagtgtgac
aatttcctcctgcacaacctaatcctggacacgggcatcacacagcagctggtggagcgc
gtctggaaggaccaggacctcaacacgtacagtctcctggctgtcttcgctgccacagat
gggggcatcacccgtgtcttcccaaacaaagccgcagatgactgggaggaggaaccggag
cccttcaacgccagcttctaccgcaggagcctggataacaagggctacatattcaaaccg
ccctaccgggatgatggctaccgggggctggatctggagaacaacaccattgggatcctg
gtgagcaccgccgtggagctcagcatagggggcaagacgctaaagccagcagtggtcggg
gtgaagctggacctggaggcctgggcagagaagttcaaggttctggcaagcaaccggaca
gaccgcgaccagctgggctcccgccggtgtgacccctcgagtagctgtgagatggactgc
gaggccaacaacaaggacctcatctgcgtcctcattgatgacggaggcttcctggtgctc
tccaaccaggaggatcactggtaccaggtgggcaagttcttcagtgaggtggacgccaac
ctgatgtctgccctctacaacaactccttctacgcccgcaaagagtcctacgacttccag
tccgtctgtgccccggaggcccagagcaacacgggtgctgcaccacgtggtgtctttgtg
cccaccgtggccgacctgctgagcctggcctggtggacctcggcggcagcctggtccctc
ttccagcagttcctctacagcctcacctacagcagctggttccagacagaggacgtcatg
gcagacggcatggaggcgagggagacgagctgcatcatgaagcagacgcagtactacttc
agcaccgtcaacgccacttacaacgccatcatcgactgcgggaactgctcgaggctgttc
catgcgcagaggctggccaacaccaacctgctcttcgtggtggctgacaagcccctgtgc
agccagtgcgagtccgtcaagctgctgcaggccgaggtcagggctcccccgagagacccg
aaccagtgtgagctggtggacaggccccgctaccggaaaggcccccacatctgcttcgac
tacaatgcaacagaagatacctcagactgcggccgaggggcgtccttcaccccctccctc
ggggtcctgctctccctgcagttgctgctcctctacgccagcaccagccggcacccgctg
cccccggccgcctgcctttaa

KEGG   Gallus gallus (chicken): 768444
Entry
768444            CDS       T01006                                 

Gene name
CACNA2D1
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-1 preproprotein
  KO
K04858  voltage-dependent calcium channel alpha-2/delta-1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    768444 (CACNA2D1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    768444 (CACNA2D1)
   04261 Adrenergic signaling in cardiomyocytes
    768444 (CACNA2D1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    768444 (CACNA2D1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   768444 (CACNA2D1)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 vWA-TerF-like DUF3983
Other DBs
NCBI-GeneID: 768444
NCBI-ProteinID: NP_001170793
CGNC: 6436
Ensembl: ENSGALG00000008486
UniProt: E1BST5
Position
1
AA seq 1082 aa
MAAGWLLVFSLTLFQSLVMNHSSEGPFPSPTTIKSWVDKMQEDLITLARTASGVEQLAAI
YLKNKDLYTVEANNPRQLVEIAARDIEKLLSNRSKALVRLAKEAEKYQASHQWRDEFGNN
DIIYYNAKDDQNDPEKNDTESGSQRIRPVFEEDPVFRRQTSYQHAAVHIPTDIYEGSTIV
LNELNWTAALDDVFKRNREEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVR
RRPWYIQGAASPKDMLILVDASGSVSGLTLKLIRTSVIEMLETLSDDDFVNVVSFNNNAQ
NVSCFNHLVQANVRNKKKLKEAVDKISAKGITDYKKGFSYAFEQLLNHSVSRANCNKIIM
LFTDGGEERAQEIFHKYNEDKKVRVFTFSVGQHNYDKGPIQWMACENKGYYYEIPSIGAI
RINTQEYLDVLGRPMVLAGEKAKQVQWTNVYLDALELGLVITGTLPVFNLTKEQNGKINQ
LILGVMGVDVSLEDIKKLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDF
LDAELENDIKVEIRKKMIDGESGEKTFETLVKSQDERYIDKGNRTYTWTAVNGTDYSLAL
VLPSYSFYYIKAKIEEPITQARYSETLKIDHFDEAGYTFIAPREYCTDVKKSENNTEFLL
NFNEFIDRNTPSSPSCNTDMVIRVLLDAGFTNELAQNYWSKLYLDGVVAQFVVTDGGITR
VFPKRAGEDWLENAETYEVSFYKRSLDNDNYIFTAPYYNKSGANSYESGIMVSKAVEITI
NGKLLKPAVVGIKIDAMKWMENFTTTTIKSLCNSEICGCEKNSMHVDCVILDDGGFLLMS
NRDEYTHQIGRFFGEIDPGLMRNLINMSLYAFNKSYDYQSVCDPEEEPKQGAGLRSAYVP
TIADILQLGWWASAAAWSILQQLFLSLTFPRFLEAADMEDDDFSTALPKTSCITEQTQYF
FENDDKSFIGIVDCINCSRLYHAEKISNTNLVFIISDSQLLCRSCDPKPLMQAEKPDEGP
NPCEMVKQPRYRKGPDVCFDEAKQEDSADCGGASGLSPSLWSMVGIQLVLLWLLSGSRHY
QL
NT seq 3249 nt   +upstreamnt  +downstreamnt
atggctgctggctggctgctggtctttagcctgacacttttccagtctctggtgatgaac
cactcgtcggagggcccgttcccttcgcccaccacgataaagtcatgggtagataagatg
caagaggacctcataacattggcacgaactgcaagtggagtggaacagcttgctgcgata
tatttgaaaaacaaagatttgtataccgtagaagccaacaatcctcgtcagctagtggaa
attgcagccagagacattgaaaaacttctgagcaacagatctaaggctttggtgcgcctc
gctaaagaagcagagaagtaccaagcatcacatcagtggagggatgagtttgggaataat
gatataatctattacaatgcaaaagatgatcagaatgatcctgaaaagaatgacactgaa
tctggcagccagagaatcagaccagtatttgaagaagatcctgttttccgacggcaaacg
tcttaccaacatgcagcagttcacataccaacagatatttatgaaggctcaacaatagtg
ttaaatgaactcaattggactgcagcactggatgatgtattcaagcggaacagagaagaa
gaccccactttattatggcaagtttttggtagtgcaactggcctcgctaggtattaccca
gcttctccatgggtagataatagtcgaactccaaacaaaatagatctatatgatgttcgc
agaagaccatggtatatccaaggagctgcatctcccaaagacatgcttattttagttgat
gcgagcgggagtgtgagtggattgacgctgaagctgatccgcacatcggtcattgagatg
ttagagaccttgtctgatgatgactttgtgaatgtagtttcatttaataataatgctcag
aacgtcagttgctttaatcatcttgtccaagctaatgtgaggaacaagaagaagctgaag
gaagctgtggataaaatctctgctaaaggaattactgattacaaaaaaggctttagctac
gcttttgaacagctgctcaatcacagcgtttctagagctaactgcaataagattataatg
ttgtttacggatggtggtgaggaaagagcacaagaaatattccataaatataatgaagac
aaaaaagtacgtgtgttcacattttctgttggtcaacataattatgacaaaggacctata
cagtggatggcctgtgaaaataaaggttattattatgaaattccatccattggagccata
agaataaacacccaggaatatctggacgttttgggaaggccaatggtgttagctggtgag
aaagccaaacaggtccaatggacaaatgtctatctggatgctctggagctgggccttgtg
attacaggaactctgcctgtcttcaatctaacaaaagaacaaaatggaaaaataaatcag
ctgattcttggagtaatgggggttgatgtctctctggaagatataaaaaagctgacacct
cgatttacgctttgtccaaatggatactactttgcaattgatcctaatgggtatgtgcta
cttcatccaaatcttcaaccaaagaatcctaaatcccaggagccagtaacactggatttt
ctagatgctgaactggaaaatgatattaaagttgagattcggaaaaaaatgatagatgga
gaaagtggagaaaaaacatttgaaactctggtcaagtcccaagatgagagatatattgat
aaaggaaatcgaacatatacatggactgctgtgaatggcactgattacagtttggcattg
gtgctaccatcatacagcttttattatattaaagctaaaatagaagaaccaataactcaa
gccagatattcagaaacactgaagattgatcattttgatgaagctggctatacgtttata
gcaccaagagaatattgtactgatgtaaagaaatcagaaaataacactgaatttttgtta
aattttaatgaatttatcgatagaaatactccaagcagtccatcatgtaatactgatatg
gtcattagagttctgctggatgcaggatttacaaatgaacttgcccaaaattattggagt
aagctgtatcttgatggagttgttgcgcaatttgttgttacggatggtggaattacaaga
gtgttccccaaaagggcaggagaagattggttggaaaatgcagaaacttatgaagtcagt
ttctataaacggagtttagataatgacaactatattttcacagctccatactacaacaaa
agcggtgccaatagctatgaatcaggtattatggtaagcaaggccgtggaaataacaatt
aatggaaaacttctgaaacctgcagttgttggaataaaaattgatgcaatgaaatggatg
gaaaatttcacaacaaccacaatcaagagcctgtgcaacagtgaaatctgtggctgtgaa
aaaaacagtatgcatgtggactgtgttatccttgatgatggtggatttcttctgatgtca
aatcgggatgaatatacccaccagattggaagattctttggtgaaattgaccctggcttg
atgagaaatttaattaacatgtccctgtatgcctttaacaagtcatatgactatcaatca
gtctgtgatcctgaagaagaaccaaagcaaggagctggacttcgttcagcttatgtgcct
acaatagcagatattttgcaactaggatggtgggcttcagcagctgcctggtctatctta
cagcagctctttttgagcttgactttcccacgtttccttgaggcagctgatatggaagat
gacgatttctctactgctctgcctaaaacaagttgtatcactgagcaaactcagtatttc
tttgaaaatgatgataaatcttttattgggattgtagactgcatcaactgttcaagactt
tatcatgcagagaagatttcaaacaccaatctagtattcattattagtgacagccaactg
ctgtgccgctcctgtgatccaaagccactgatgcaagcagagaagccggatgaagggcca
aatccttgtgaaatggtcaaacagcccagatacagaaaaggtcccgatgtctgttttgat
gaagccaaacaggaagattcggctgattgcggtggtgcctctggtttgagtccatcactg
tggtctatggtaggaattcagttggtcctgctttggctcttatctggcagcagacactac
cagttatga

KEGG   Gallus gallus (chicken): 777366
Entry
777366            CDS       T01006                                 

Gene name
CACNB1
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-1 isoform X1
  KO
K04862  voltage-dependent calcium channel beta-1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    777366 (CACNB1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    777366 (CACNB1)
   04261 Adrenergic signaling in cardiomyocytes
    777366 (CACNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    777366 (CACNB1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   777366 (CACNB1)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 DUF6374
Other DBs
NCBI-GeneID: 777366
NCBI-ProteinID: XP_015155011
CGNC: 58858
Position
27
AA seq 613 aa
MVREGGMARPPYSSAQDIQMDVFDNAALQGKYSKRKSRFKRSDGSTSSDTTSNSFVRQGS
AESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSANDDV
PVQGMAICFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLENMRLLQEQKMRQN
RLSSSKSGDNSSSSLGDVVTGTRRPTPPASGALDTPSFAFEPDELEEEEAAETHCSPKSS
VSSVTTPPAHSKRIPFFRKAEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLK
HRFDGRISITRVTADISLAKRSVLNNPSKHTIIERSSTRSSLDVLAEVQSETERIFELAR
TLQLVALDADTINHPAQLAKTSLAPIIVYIKIASPKVLQRLVKSRGKSQAKHLNVQMVAS
DKLAQCPPEMFDIVLDENQLEEACEHLAEYLEAYWKATHPPSSNPPNPLLNRTMATAALA
ASPAPVSNLQGPYLVHGEPPGEGNLREGGPIPPPARAAPPRRLSRQDTFDSETPGSRDSA
CTEPGNSCMDVETDPGEEDPRAPPGPRGAWDEERGRGPRGRAKGHDRYCPEPPEPLGLDQ
SDTEGWGQEVYIR
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggtgcgggaggggggcatggcgcgcccgccctacagctccgctcaggacatccagatg
gacgtcttcgacaacgcagccctccagggcaagtacagcaagcgcaagagccgcttcaag
cgctcggatggcagcacctcgtctgacaccacctccaacagcttcgtccggcagggctca
gctgagtcctacaccagccgcccctcggactcggatgtgtcactggaggaggaccgcgag
gcgctgcgcaaagaggctgagcgccaggcactggcacagctggagaaagccaagacgaag
ccagttgcatttgctgtccggacaaatgtcggctacaacccgtctgccaatgatgatgtg
cctgtgcagggcatggccatctgctttgagcccaaagacttcttgcacatcaaggagaag
tacaacaacgactggtggatcgggcggctggtgaaggagggctgcgaggtcggcttcatc
cccagccctgtcaaactggagaacatgcggctgctgcaggagcagaagatgaggcagaac
cgactgagctccagcaaatcgggtgacaactccagctccagccttggcgacgtggtgacg
gggacgcgcaggcccacccctccggccagtggtgccctggacacacctagctttgccttt
gagcccgatgagttagaggaggaggaggctgcggagacccactgctcccctaagagtagt
gtgagcagtgtcaccaccccccccgcccactccaagcgcatccccttctttaggaaggct
gagcacgtgccgccctacgatgtggttccctccatgcggcccatcatcctggtggggccg
tcgttgaagggctacgaggtgacagatatgatgcagaaagcactgtttgatttcttgaag
catcgctttgatggcaggatctccatcacgcgggtgacggccgacatctccctcgccaag
cgctctgtgctgaacaaccccagcaaacacaccatcatcgagcgctccagcacacgctcc
agcctggatgtcttggctgaggtgcagagtgagacggagcgcatcttcgagctggcccgg
accctgcagctggtggccttggacgccgacaccatcaaccacccggcccagctggccaag
acctccctggcacccatcatcgtctacatcaaaatcgcctccccaaaggtgctgcagcgg
ttggtgaagtcccggggcaaatcccaggccaagcacctcaacgtgcagatggtggcctcc
gacaagctggcgcagtgcccgcctgagatgtttgacatcgtgctggacgagaaccagctg
gaggaggcctgcgagcacctggccgagtacctggaggcctactggaaggcaacgcacccc
cccagcagcaacccccccaacccgctgctcaaccgcaccatggccacagccgcgctggcc
gccagccctgcgcccgtctccaacctgcagggtccgtacctggtgcacggggagccgccg
ggcgaggggaacctccgggagggggggcccatcccaccgcctgcccgcgcggcccccccc
cgccgcctgtcccgccaggacaccttcgactcggagacccccggcagccgggattcagcc
tgcacagagcccggcaactcctgcatggacgtcgagaccgatcctggtgaggaggacccc
cgggccccccccggtccccgtggtgcgtgggacgaggagcggggccggggaccacgggga
cgtgccaaaggccacgaccgctactgcccggagccgccggagcctttgggtctggaccag
agtgacacagagggctggggccaggaggtttacatccgctag

DBGET integrated database retrieval system