KEGG   Gallus gallus (chicken): 100859610
Entry
100859610         CDS       T01006                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1 isoform X2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100859610 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100859610 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100859610 (CREB3L1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100859610 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 TPR_MLP1_2 Tcf25 ADIP RNase_Y_N JMY
Other DBs
NCBI-GeneID: 100859610
NCBI-ProteinID: XP_003641438
CGNC: 6358
Ensembl: ENSGALG00000008393
Position
5
AA seq 505 aa
MDSILEPFAAERLFPPAGPGFLDLGDFSEADFLSNVHFSENLDHFSDNMDDFSNDLFSSF
FDDPVLAEKNPLLDMDLDPPTPGIQAEHSYSLSGDSAPQSPLMPVKTEDNANELENGVWS
LGPKLCSIMVKQEQNLALDPPESQLAASSRPVLNLNPLQRLPVPEETPIEMTPAPVIKAE
PKEVNQFLNVPADDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPARPAARSSTAISSSPL
LTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKNKISAQE
SRRKKKEYVECLEKKVETYTTENNELWKKVETLESANRTLLQQLQKLQALVAGKVSRPYK
MASTQTGTCLMVLVLCFVLILGSLMPCLPEFSTASQTVKATPAPDIYTTSKIQSRSLLFY
DEGAGSLEESYSSFLTMDHPEGWEAEKGQSDEPRPHLARTHETDKYMSKSHLENPDQNQT
DPTLTHLKEQFHERETSSSETAEYL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggacagtatcctggagcccttcgccgccgagcggctcttcccccccgccggccccggc
ttcctcgacctgggcgacttcagcgaggcggatttcctcagcaatgtgcatttctccgag
aacctggatcacttctctgacaacatggatgatttctccaacgacctcttcagcagtttc
ttcgatgacccagttctggctgaaaagaacccgctgctggacatggacctggacccaccc
actccaggcatccaggcagagcacagctactccctcagcggagactctgctccccagagc
cccctcatgcctgtcaagactgaagataatgctaacgagctggagaatggagtgtggtct
ctggggcccaagctctgctccatcatggtgaagcaggaacagaacctggctctagacccg
cctgagtcccagctggctgccagctccagacctgtgctgaacctcaaccctctgcagaga
ctgccagtccccgaggagactcccattgaaatgactccagcacctgtgatcaaagctgaa
cccaaagaagtgaaccagtttctaaacgtacctgcagatgacctggtgcagatgcctcca
actccacccagcagccatggcagtgacagcgacgggtcccagagccctcggtccctgcct
ccctccagcccagcccgacctgctgctcgctcttctactgccatctcctcctcacctctc
ctcacagcaccacacaaattacaagggacctccggcccactgctcctgactgaagaggag
aaacgcaccttgattgctgagggctaccccattcctaccaagctgcccctcaccaaagca
gaggagaaagcactgaagagggtccggaggaaaataaagaacaagatctctgctcaggag
agtcgcagaaagaagaaggagtatgtggaatgtttagagaaaaaggtcgagacatacacg
acagaaaataatgaactctggaaaaaagtggagaccttagaaagtgcaaacaggactctg
ctccagcagttacagaagctgcaggctctggtagctgggaaagtctccagaccgtacaaa
atggcttccacacagactgggacctgcctaatggtgctggtgctctgcttcgtcctcatc
ctgggatccctgatgccctgtctcccagagttctctacagcatcacagacagtgaaagca
acaccagcgccagacatttacacaactagtaagattcagtcacggagcctcttgttctat
gatgagggtgctggctccttagaagagagctatagctccttcctaaccatggaccatcct
gaggggtgggaggctgaaaaagggcagtctgacgagccaaggcctcatctggcaaggacg
catgaaacagacaaatatatgagcaagtcccatctggagaatcctgaccagaaccaaact
gacccaactctaacccacctcaaagagcaatttcatgagagggaaacaagctccagtgag
acagctgaatacttgtag

KEGG   Gallus gallus (chicken): 395099
Entry
395099            CDS       T01006                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    395099 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395099 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395099 (CREB1)
   03029 Mitochondrial biogenesis [BR:gga03029]
    395099 (CREB1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    395099 (CREB1)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    395099 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 395099
NCBI-ProteinID: NP_989781
CGNC: 49169
Ensembl: ENSGALG00000008494
UniProt: Q7SX83
Position
7
AA seq 327 aa
MTMESGAENQQSGDAAVTEAETQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETAAPAIATVTVPTPIYQTSSGQYIAITQGGAIQLS
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagccgttacagaggca
gaaacccaacagatgacagtacaggcacaaccacagattgcaacgttagcccaggtatct
atgccagcagctcacgccacgtcttctgcacccacggtgaccttagttcagctgcccaat
gggcagacagttcaagtgcacggcgtaattcaggctgcccagccatcagttattcagtct
ccacaggtccagacagttcagatttcaactatagcagaaagtgaagactcacaggaatca
gtggacagtgtcacagattcacagaaacggagagaaattctttccagacgaccctcctac
agaaaaattttgaatgacttgtcctcagacgccccaggagtgccaaggatcgaagaggaa
aagtctgaagaggaaacagcagcacctgccattgccactgttacggtgccaactcccatt
taccaaaccagcagtgggcagtacattgctattacgcaaggaggagcaattcagttgtct
aacaacggcacggatggagtacaaggtctccagacgttgactatgaccaatgcagctgca
acacaacctggcactaccattttacaatatgcacagaccacagatggacaacagatactt
gtacccagcaaccaagttgtagtacaagctgcctcaggagatgtacagacctaccagatt
cgcaccgcccctaccagcaccattgcacctggagtagtcatggcatcatctccagcactt
ccaacccagccagcagaagaggccgcacggaagagagaagtgcgtctaatgaagaacaga
gaggcagcacgtgaatgtcgcaggaagaaaaaggagtatgtgaaatgtctagaaaatcga
gtggctgtgcttgaaaaccaaaacaagacactgattgaggagttgaaagcacttaaagac
ctttactgccacaaatcagattaa

KEGG   Gallus gallus (chicken): 395693
Entry
395693            CDS       T01006                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04137  Mitophagy - animal
gga04141  Protein processing in endoplasmic reticulum
gga04210  Apoptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    395693 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395693 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    395693 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    395693 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395693 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395693 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395693 (ATF4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    395693 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DUF3450 Baculo_F ATG14
Other DBs
NCBI-GeneID: 395693
NCBI-ProteinID: NP_990211
CGNC: 9204
Ensembl: ENSGALG00000012135
UniProt: Q9W610
Position
1
AA seq 354 aa
MSLLNNEMLLGESSPFSQPCSVAEESLGLLDDYLEVAEPLGSHGFSSDKAKAVSSNWLAV
DSLGNTIDSSQEDAFSGMEWMVEKMDLKEFDFDALLGMEHLEATVSPDELMATLEDTCDL
LFNPTTQEFHNKEPPLIPDLITNLPESPIGADPMAPLSSLWSFPLSPGSLTSVPDHSFSL
ELGSEVDVLEGERKQEGPTFLVVITKSEKEEENHSDDSGICMSPDSYLGTPQHSPTNSLG
SPNDNPFPTDAACGSVRSKPYDHPAEKVASAKVKGEKKIDKKLKKMEQNKTAATRYRQKK
RAEQEALSGECRDLEQKNQALKEKADSLSKEIQYLKDLIEEVRKAKVKRARVPE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagcctcttgaacaacgagatgctgttgggggagtcctcccccttcagccagccgtgt
tcggtggctgaggaaagtctgggactcctcgatgactacctggaggtggccgagcccctc
ggttcgcatgggttctccagcgacaaggctaaggcagtctcctccaattggctcgctgtg
gacagtttaggcaacaccatagatagcagccaggaggatgccttctctggcatggagtgg
atggtggagaagatggatctgaaggaatttgattttgatgccctgttaggtatggaacat
ctggaagccaccgtctcaccagacgagctgatggccacgttggaagacacgtgtgatctc
ctatttaaccctaccacccaggaatttcacaacaaagaacctccactcatacctgatcta
atcaccaatctccctgaatctccaattggagcagatcccatggcccctttatcttccctc
tggtcttttcccctctccccagggtctctgacttctgttccagaccattcatttagttta
gaactaggtagtgaagtggatgttctggaaggtgaaaggaaacaggagggccccaccttt
ctggtagtgatcaccaagtcagagaaagaggaggagaaccattccgatgatagtggaata
tgcatgagcccagactcttatttgggaacaccccaacatagtcctaccaattcacttgga
tcacccaatgacaacccgttccctacagatgccgcctgtggctctgtgcggtccaaacca
tatgaccaccctgctgagaaggtagcgtcagcaaaggtgaaaggagaaaagaaaatagat
aaaaaactgaaaaagatggagcaaaataagacagctgccacacgttaccggcaaaagaag
agggcagaacaggaggcgctgtcaggggagtgcagagatttggaacagaagaatcaggcc
ctgaaagagaaagcagattccctgagtaaggaaatccagtacttgaaagatctgattgaa
gaggtaaggaaggccaaagtcaaaagagctagagtccctgagtag

KEGG   Gallus gallus (chicken): 395727
Entry
395727            CDS       T01006                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395727 (ATF2)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395727 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    395727 (ATF2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    395727 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Other DBs
NCBI-GeneID: 395727
NCBI-ProteinID: NP_990235
CGNC: 7057
Ensembl: ENSGALG00000009287
UniProt: O93602
Position
7
AA seq 487 aa
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRNKIEEPSVVETTHQDSPL
PHPESTTNDEKEVSLQQTAQPTSTIVRPASLQVPNVLLTSSDSSVIIQQAIPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITNSNVHVPAAVPLVRPVTMVPSI
PGIPGPSSPQPVQSEAKLRLKAALTQQHPQVTNGDTAKGHPSGLVRTQSEEPRPQSLQQP
ATSTTETPASPAQPTQQTPNTGGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQNEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQLADQSSEPGLPQVGVVPPS
QAQPSGS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttttatgcactgcccctggatgtggccagcgttttaccaat
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccggct
cgtaatgatagtgtcattgtggctgatcagacaccaacaccaactcgattcttgaagaac
tgtgaagaagtgggcttattcaatgaattagcaagtccttttgaaaatgagtttaaaaag
gcttctgaagatgatattaagaaaatgcctctagatctgtctcctcttgcaacaccaatt
ataagaaacaaaattgaagaaccttctgttgtagagacgactcatcaagatagtccttta
cctcatccagagtctactaccaatgatgaaaaggaagtgtccctgcagcagactgcacag
cccacatcaacaatagttcgtccagcatcgctacaggttcctaacgtactacttacaagt
tctgactcaagtgttattattcagcaggcaataccatcaccaacgtctagtactgttatt
acccaggctccatcctctaacagaccaatagttccagttccaggcccgtttcctctgctg
ttacatcttcctaatggacaaaccatgcctgttgctattcctgcatctattacaaattcc
aacgtgcatgtccctgctgcagttccacttgttagacctgtcaccatggtgcctagtatc
ccaggaatcccagggccttcctccccacagccagtgcagtctgaggctaaattgagactg
aaagcagccttgacccagcagcaccctcaggtaacaaatggagatactgccaagggacat
ccgagtgggttggttaggactcagtcagaagagccgcgaccacaatcactacagcaacct
gcaacttcaacaactgaaacaccggcatcaccagctcagcctacacaacaaacaccaaat
acaggtggtcggcgaagaagagctgctaatgaagaccctgatgaaaaacgaaggaagttt
cttgagcgaaaccgagctgctgcttccagatgccgacagaaacggaaggtctgggtacag
tcattggagaagaaggctgaggacctgagctcgctaaatggccagttacagaatgaagtc
accctgctgagaaatgaagtggcccagctgaaacagcttcttctggctcataaagattgc
cctgtaaccgccatgcagaagaaatctggctatcatactgcagataaagatgacagttca
gaagacatctcagtgccaagcagcccacacacggaagctattcagcacagctccgtcagc
acttccaacggtgtaagctccacttccaaggcagaggcggtggccacctcagtgctcacg
cagctggcggaccagagctcggagcccgggcttccccaggtcggtgtggtgccgccctcc
caggcgcagccctcggggagttga

KEGG   Gallus gallus (chicken): 418123
Entry
418123            CDS       T01006                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    418123 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    418123 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    418123 (CREB3L2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    418123 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB Fmp27_WPPW Jnk-SapK_ap_N TPR_MLP1_2 Goodbye JMY APG6_N FlaC_arch LMBR1 TBCA DUF724 ADIP
Other DBs
NCBI-GeneID: 418123
NCBI-ProteinID: XP_004937934
CGNC: 9755
Ensembl: ENSGALG00000012877
Position
1
AA seq 519 aa
MEVCESGEQPPLLHWDRKLSELCEPADPDTLLGHTHFTEFLDEFSTDVLGQLLNDPFLSE
KNEVMEVELSPASPAPLIQAEHSYSLCGDSRPQSPLTHISTDDNFNEGDLENEDWCLGSE
LTPAAIKTEPVLCETSGLTPSVSLTVTATSLDGEQAELHTDALMKPLSQRALPEIKLEPH
EVDQFLNLSSKEVDPLHLPPTPPSSHGSDSEGGQSPARSLPPSSPIQLQAAAKVVSRTAS
ALSNSPLLTAPHKLQGTGPLILTEEEKRTLIAEGYPIPTKLPLTKAEEKVLKKIRRKIKN
KISAQESRRKKKEYMDSLEKKVENCSNENSELRKKVEVLESTNRTLLQQLQRLQAMVAGK
VSRSCKAASTQTGTCLMMVVLCFAVVFGSFSQSYGPYPSATKMVLPRQHSSPESYTDSIV
RSRSLLIYEEPHQLEESSNPISSADRNDRHADTPKYAALALEAVPVMQQDDIMEFTIANE
TRLEKSVLLGLQQHRVNSEIEGNETLKIIELDRRVNATS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggaggtgtgcgagagcggcgagcagccgccgctgctgcactgggatcgcaagctgagc
gagctgtgcgagcccgccgaccctgacaccctgctgggccacacgcacttcacagaattc
ctggatgagttctcaactgatgtcctaggccagctcttgaacgatcccttcttgtctgag
aagaatgaagtgatggaggtggaactgtctccagcatccccagcgccactcatccaggca
gagcacagctactccttgtgtggggattcccggccccagtcaccgctgacccacatctcg
actgatgacaactttaatgaaggtgacctggaaaatgaagactggtgtctgggttcagaa
ctgactccagcagcaataaagactgagccagtgttgtgtgagacgtcaggccttactccc
tctgtcagtctcactgtcactgccacgtcgctggatggagaacaagctgagctgcatact
gatgccctgatgaaaccactgagccagagagctcttccagagattaaattggagcctcat
gaagtggatcagtttctgaacctctcttctaaggaagttgatcccctgcatttgcctcca
acccctcccagcagtcatggcagtgactctgaaggagggcagagcccagctagatctctc
cctccttcaagcccaatccagctgcaagccgcagctaaagtggtgtcacgcacagcttca
gcgctctccaattcccctctcctgactgcaccacataagttgcaggggactggcccactc
atcctgacagaggaggagaagaggacactgatagcagaggggtacccaatccctaccaaa
ctgcccctgacgaaagcagaggagaaagtgctgaagaaaatccgcagaaaaataaagaac
aagatctctgcccaggaaagcagaagaaaaaagaaagaatacatggacagtctggaaaaa
aaagttgagaactgttcaaatgaaaacagtgagctacgtaagaaggttgaagtcctggag
agtactaacagaacacttctgcagcagctgcagagactccaggccatggttgctgggaag
gtgtcccgttcatgtaaggcagctagcacacagacagggacctgtcttatgatggtggtg
ctgtgctttgcagttgtttttggcagcttctctcagagctatggaccatatccttctgct
acaaagatggtgttgcccaggcagcattcctcaccagagtcctacacagactccattgtg
aggtcacgaagtctgctgatttatgaagagcctcaccaactggaggagtcgtcaaacccg
atctcatctgcagatcgaaacgacaggcatgcagacacccccaagtatgcggcgctagct
ctggaagctgtgccggtgatgcagcaggatgatatcatggagttcacaatagccaatgag
acacggctagagaaatcagtgctgctgggcctacagcaacacagagtcaactctgaaata
gaaggaaatgaaactctgaagataattgaattagatagaagagtcaatgccacctcttaa

KEGG   Gallus gallus (chicken): 427417
Entry
427417            CDS       T01006                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    427417 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    427417 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    427417 (CREB3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    427417 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB CASP_C JMY HAUS-augmin3 ADIP
Other DBs
NCBI-GeneID: 427417
NCBI-ProteinID: XP_424990
CGNC: 1809
Ensembl: ENSGALG00000002523
Position
Z
AA seq 441 aa
MAGPEPLAALPDGDLLDFLLNDDAPAAGSPAGDGPLLGDWVLPELELLDKEMDSFISSLL
SPSEDEPCLLQGCLPADSDSSTSEDQNPFHSSGSDVASSPQSSDIVQFDHNYSLHQDWPA
LESVRSDMAEGDVSIDLETWMCLEGTNETLQESCSFPVTVAVDAGPQLMPGAPMQSNFPE
LVLTEEERQLLEKDGVSLPTCLPLTKAEERLLKKVRRKIRNKQSAQDSRRRKKIYVDGLE
NRVAACTAQNHELQKKVQLLQKQNMSLLEQLRKLQALVRQSTTKTTTASTCIMVLVLSFC
LILSPSLYSFGSRGPQPEFRVLSRQIREFPNKVWQAAPAVQEEVVLERLSPEPEDTSLGS
LNQSREEGQSPPKPDPRSAFNGNSSSDPPAGSELGHPQPQEQQSRRDALHSEVLAPWKDE
NQEWVERTTSVVIQQHRTDEM
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcgggccccgagcctctggccgcgctgccggacggggacctgctcgacttcctgctg
aacgatgacgcgccggcggcggggagccccgcgggggacggcccgctgctgggggactgg
gtgctgccggagctcgagctcctggacaaggagatggacagcttcatcagctccctgttg
agcccctctgaggacgagccgtgcctcctgcagggctgtttgcctgctgacagtgacagc
agcacttctgaggatcagaacccgttccatagctctggcagcgatgttgccagcagccct
cagagctcagacatcgtgcagtttgatcacaactattccctccatcaagattggccggca
ttggaaagcgtgaggtctgacatggcagaaggagatgtttccattgacctcgagacgtgg
atgtgtttggaaggcacaaatgagacgctgcaagagagctgcagttttcctgtcactgtt
gctgtggatgccggaccccagcttatgcctggagcccccatgcagtccaacttcccagag
ctggtcctgactgaggaggagaggcagcttctggagaaggatggtgtttccttaccaacc
tgtttgccactgaccaaagctgaagagcgacttctgaagaaagtgcgtcggaagatccgg
aacaagcagtcagcccaggatagtcgtcgcaggaagaaaatctatgttgatggcctggag
aacagggtggcagcttgcacagcccaaaaccatgagctgcagaagaaggtgcagctactg
caaaagcagaacatgtctttgctggagcagctgcggaaactgcaggctttggtgagacag
tccaccaccaaaactaccacagcgagcacctgcatcatggtcctggtcctttctttctgc
ctcattctctcacccagcctctactcgtttggcagtagagggccgcagccagagttcaga
gtcctgtcgcggcagattcgtgagttcccaaacaaggtctggcaggcagcacccgctgtg
caggaggaagttgtactggagaggctcagtccagagcctgaagacacctcgttgggcagc
ctcaatcagtcacgggaagaggggcagagtccacccaagcctgatccaagatctgcattc
aacggcaactcatcctcagaccctcctgcgggctctgagctgggccatccccagcctcag
gagcagcagtcccggagggacgccttgcactcggaagtgctggcaccatggaaagatgag
aatcaggagtgggtggagcgcaccaccagcgttgtcatccagcagcaccgcaccgatgag
atgtga

KEGG   Gallus gallus (chicken): 428333
Entry
428333            CDS       T01006                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    428333 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428333 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428333 (CREB3L3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    428333 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF1664 pEK499_p136 ADIP MCU RNA_polI_A14 BORG_CEP
Other DBs
NCBI-GeneID: 428333
NCBI-ProteinID: XP_004948873
CGNC: 854
Ensembl: ENSGALG00000001252
UniProt: E1BSG6
Position
28
AA seq 493 aa
MCCWSLNFATRVRASQGRRWPGWASRTPKELRAKDGSAGSPLELGSHTAMASTVGGLDSI
DLLDLLFDRQDGILRGVELGTTSPGTWHEDGRAQDGEDFLSSILGSGDSISDSPSWSPGV
SDSGVSEDPPSDQLDSPPGCCDGGLSEAPYAFTNSCQVLTHPGGTGAPHPEVSIDLDMWN
PGFFLEEGRGLSTVPVPASCTLTVKDLLLSGSSDAQPQMPSSLLRQGQGQFQELVLTEDE
KKLLAKEGVSLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLESRMSACT
AQNQELQRKVLHLEKQNSSLLEQLKKLQALVVQSSNKAAQTGTCIAVLLLSFALIVFPSI
SPFAASKAETGGDFGPVRVFSRSLHNTAASRVAYAQPRAGDEKPPEPLWSKHQDETETLH
KAFGSSSFTPHLDKAPTRNSTPPLASEGLSQSDGDQSGTALGDSTALHQSLTSLAWTEAD
HSRPTVLEPAEEL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtgctgttggagtttaaactttgccactcgggtcagggcatcgcaggggaggaggtgg
ccaggctgggcgtcccgaacaccgaaggagttgagagccaaggacggatctgcgggctcc
ccgctggagctgggatctcatacagccatggcctctactgtgggtggccttgacagcatc
gacctgctggacctcctctttgatcgccaggatggaatcctccgtggtgtggagctggga
acgacatccccgggcacctggcatgaggatgggcgtgcccaggatggcgaggacttcctt
agctccattctgggctctggggactccatatcagactcgcccagctggtccccgggtgtc
agcgacagtggagtctccgaggaccccccctctgatcaactcgacagcccccccgggtgc
tgtgacggagggctcagcgaggccccatacgcctttaccaactcctgccaggttctgacg
caccctgggggcaccggagccccccaccctgaggtctccattgacctggatatgtggaac
cctggcttcttcctggaggagggccggggtctgtcgacagtccctgtgcctgcgtcctgt
accctcactgtcaaggatctgctgctctcgggcagctctgatgctcagccacagatgccc
agctccctactaaggcagggccaggggcagttccaggagctcgtgctgacagaggatgag
aagaagctgctggcaaaggagggggtatccctgcccacgcagctgcccctcaccaagtat
gaggagcgggtgctgaagaagatccggaggaagatcagaaacaagcagtcagctcaggag
agccgcaagaagaagaaagagtatatcgatgggctggagagtcggatgtcagcgtgcacg
gctcaaaaccaggagctgcagaggaaagtcctgcacctagagaagcagaactcctctctc
ttggagcagctgaagaagctccaggccctggtggtgcagtcaagcaacaaagcagcacag
acaggaacctgcattgcggtcctgctgctctccttcgcgctcattgtcttcccttccatc
agccctttcgccgctagcaaggctgagacaggtggtgacttcggaccagtgcgagttttc
tccaggtccctgcataacacagctgcctcccgtgtggcttacgcacagccccgagctggg
gatgagaagcccccagagccactgtggtcaaagcaccaggatgaaactgagacactgcac
aaagcctttggtagcagctccttcactccacacctcgataaagcccccacccgaaacagc
acaccaccacttgcctcagaagggctgagccagagtgatggggaccaatctggcactgca
ttgggggacagcactgcactgcaccaaagcctgacgtcgctcgcttggaccgaagctgac
cacagcaggcccacagtgctggagccagctgaggagctttaa

KEGG   Gallus gallus (chicken): 428435
Entry
428435            CDS       T01006                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X3
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428435 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    428435 (CREB5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    428435 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N DUF6262 NDUFB11 DivIC
Other DBs
NCBI-GeneID: 428435
NCBI-ProteinID: XP_004939439
CGNC: 8458
Ensembl: ENSGALG00000038265
UniProt: A0A3Q2UBL5
Position
2
AA seq 369 aa
MFCTSAGNSGSVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPME
RQMSMNSNIMGMQGPNLNNPCASPQVPPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMM
EMMSSRQDQTPHHHMHSHPHQHQTLPPHHSYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH
LHAHPAHHQTSPHPPLHSGGQAQVSPAAQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRR
KFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHK
DCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSDVVGSSTLTQLAS
HRTDINPIL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttctgcacctcagcagggaattcaggctcagtgatgtccatgaggcctgtcccaggt
tctctgtcttcgctattgcatctacacaacagacaaagacagcctatgccagcctctatg
cctggcaccctgcccaaccctaccatgcctggatcttctgctgtactcatgcctatggag
cgacaaatgtcaatgaactccaacatcatgggaatgcaggggccaaacctcaacaaccct
tgtgcttcacctcaagtccccccaatgcattcggaagccaaaatgagattgaaggcagca
ctgactcatcaccctgccgccatgtcgaacgggaatatgaacaccatgggccacatgatg
gaaatgatgagctcgcggcaggaccagacgccacaccatcatatgcactcacatcctcat
caacaccagacactgccacctcaccactcctacccccaccagcaccagcacccagcgcac
catcctcatcctcagcctcatcaccagcagaatcacccccaccaccactcccactcgcac
cttcacgcacacccggcacatcaccagacctcgccgcacccaccgctgcattcgggcgga
caagcacaggtttcaccggccgcacagcaaatgcagcccacgcagacgatacagccgccg
cagcctactggaggccgccggagaagggtggtggatgaagaccctgatgagaggaggagg
aaatttctggagaggaaccgagccgctgccacacgctgcagacagaagaggaaggtctgg
gtgatgtcactggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaat
gaggtctccatgctgaaaaatgaggtagcacagctgaaacagttgttgttaacgcataaa
gactgtccgataacagccatgcagaaagaatcacaaggatatctaagtcctgagagcagt
cctcctgcgagcccggtcccagcatgctcccagcagcaagtcatccagcacaacaccatc
accacctcctcctccgtcagcgatgttgtgggcagctccactctcacccagctcgccagc
cacagaacagacatcaaccccatcctttaa

DBGET integrated database retrieval system