KEGG   Gallus gallus (chicken): 101748386
Entry
101748386         CDS       T01006                                 

Gene name
KCNE1
Definition
(RefSeq) potassium voltage-gated channel subfamily E member 1
  KO
K04894  potassium voltage-gated channel Isk-related subfamily E member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101748386 (KCNE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    101748386 (KCNE1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   101748386 (KCNE1)
SSDB
Motif
Pfam: ISK_Channel
Other DBs
NCBI-GeneID: 101748386
NCBI-ProteinID: XP_015155647
CGNC: 11958
Position
1
AA seq 126 aa
MLVLSNDTALSILLSKLLQDHLEQTNSTAPSTVGSTGGSLEIIYVLMMVGLFGFFTVGVM
VTNIRARRLEDSHNPYNTYIATDIWHKKDQEYFQAKLIENYKLCCVFENQLAVEQPSIHI
PEEKSS
NT seq 381 nt   +upstreamnt  +downstreamnt
atgttggtgctgtctaatgacacagccctgagcattctcctctccaagctgcttcaagac
cacctggagcagacaaatagcactgccccctctacagttggaagcactggcggcagcctg
gaaatcatctacgtgctgatgatggtcggtctctttggcttcttcaccgtgggagtcatg
gtgaccaatatccgtgctaggagactggaggactcccacaacccctacaacacgtacatt
gcaacagacatttggcacaagaaggaccaggagtattttcaagccaagcttatagaaaat
tacaagctgtgctgtgtctttgaaaaccagctggcagtagagcagccgagcatacacatt
cctgaggaaaagtcttcctag

KEGG   Gallus gallus (chicken): 423090
Entry
423090            CDS       T01006                                 

Gene name
KCNQ1
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1 isoform X1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423090 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    423090 (KCNQ1)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   423090 (KCNQ1)
SSDB
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 WDCP DUF6526
Other DBs
NCBI-GeneID: 423090
NCBI-ProteinID: XP_015142166
CGNC: 4878
UniProt: A0A3Q2U6I7
Position
5
AA seq 834 aa
MPWVVPPTDRSSAKPFVEHFVPTGASGSRKTGEAAGWGALEAAPCSFAWKRPRARCLLAA
GARCLLAAGARTGGAAPPGGRAAPGLRAGHGPAPTRPVSASPSPFLARSRPRGAGPATAG
GRPALALVGGSVRQRSPDAAASSAMSSSSPPGEHRSRSLGRLSLPRKGSMTPGKKPSSLE
LAESVPNAHYAPLPEAQGGQPPAGSGPGAARERPPHVRSEVVVVGAESARPPVSLDPRVS
IYSLRKPLLSRSNIQGRVYNFLERPTGWKCFVYHFTVFLIVLICLIFSVLSTIEQYAALA
TGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMIV
LCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLG
LIFSSYFVYLAEKDAVNDSGETEFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCF
SVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTW
KIYIRRPARNYHLLSPSPKPKKSVMVKKKKFKLDKDNGPSSPDKMLTVPHITYDHVTDDK
KPDFCFDTYENSDCQRSWPSFSTDQQSSSAPSSPVKKSPTFLDVNTGPFIRTNSFADELD
LEGETLLTPITHISQLREHHRAAIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHL
NLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGNNTIGARLNRVEDKVTQMDQKLNLIT
EMLHRLVSSHQRDQGNNRSSQRGNSVNSDLFIPNNTLPTYEQLTVPERNEDDIS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgccgtgggtcgtgccaccgacagaccgcagctctgcaaaaccctttgtggagcacttt
gtccctacgggtgccagcgggagcaggaagacaggagaagctgctggctggggggcgctg
gaagctgcaccctgctcctttgcatggaagaggccgcgtgcgcgctgtttgctggctgca
ggtgcgcgctgtttgctggctgcaggtgcgcgcacaggtggagcagcgcctccgggcggg
cgggcggccccagggctgcgggcagggcacggcccggctccgacccgccccgtctcggct
tccccctcacctttcctggcccggagccgcccccgaggggccgggccagcaacggcggga
ggacgcccggctctggctctggtcggcggctccgtgaggcagcgcagccccgacgccgcc
gcctcctcagccatgtcctccagctctccccccggcgagcacaggagccggagcctgggc
cggctttcgctgcccaggaagggcagtatgacgcccggcaagaagccctcctcgctggag
ctggccgagagcgtcccgaacgcccactacgccccactccccgaagcgcagggcgggcag
ccgccggcaggcagcggtcccggagcggcgagggagcggccgccgcacgtgaggagcgag
gtggtggtggtgggcgcggaaagcgcgaggcccccggtcagcctggacccccgcgtctcc
atctacagcctgcgcaagccgctgctgagccgcagcaacatccagggccgggtgtacaac
ttcttggagcggccgacgggctggaagtgcttcgtgtaccacttcaccgtcttccttatt
gtgctgatatgccttatcttcagtgtgctttctacaattgaacagtatgcagctcttgcc
acagggacgctgttttggatggaaatcgtgttagtggtgttctttggaacagaatatgtg
gttcggttatggtcagcaggatgtcgcagtaaatacgttggaatatggggaaggcttcgt
tttgctaggaagcctatttcaatcatcgatttaattgtagttgtcgcttccatgatagtt
ctgtgtgtgggctctaaaggtcaagtctttgcaacctcagctatcaggggcatccgtttc
ctgcagattttgcggatgctgcatgttgaccgtcagggtggcacatggaggctgctggga
tcagttgtcttcatacacagacaagaactgataactacactctacattggatttttgggc
ctgatcttttcctcttattttgtgtacctggctgaaaaagatgctgtaaatgattctgga
gaaacggagtttggcagctacgcagatgccctgtggtggggagtagtgacagttacaact
atcggctatggggataaagtgcctcaaacttggattggaaagaccattgcctcttgtttt
tcagtgtttgcaatttcattttttgcactacctgcgggaatccttggttcaggctttgcc
ctgaaggtacagcagaaacaaagacagaagcatttcaaccgtcaaattccagctgctgct
tctctcatacagacggcctggagatgctatgcagcagaaaacccggactcttctacgtgg
aaaatatatattcgaagacctgccagaaattatcatttgctgtcacccagtccaaaacca
aagaaatcagtgatggttaaaaagaagaaatttaagctagacaaggacaatgggccttct
tctccagataagatgttaaccgttccacacatcacttatgaccacgtgacggatgacaag
aaacctgatttctgttttgatacatatgagaattctgattgtcagcgttcctggccatcc
ttttccacagaccagcaatcttccagcgctccttcctctccagtgaaaaaaagcccgacg
tttttagatgtgaacacaggacccttcatcaggaccaacagttttgccgatgagcttgac
ctggagggtgaaacgctgttaaccccaataactcacatctcacagctgcgagaacatcac
cgtgctgcaattaaagtgattcgaagaatgcagtattttgtggcgaagaaaaagtttcag
caagctagaaagccttacgatgtccgagatgttattgagcagtattcccagggtcatctc
aacctgatggtgcgaatcaaggagttacagaggaggttggatcaatccatagggaaacca
tctctttttatctctgtctcagaaaaaagcaaagatcgagggaataacacgattggtgcc
aggctgaacagagtggaggacaaggttacgcagatggaccagaaactgaacctcattact
gagatgctgcatcgtctggtttcaagtcatcagagggatcaaggaaacaacaggtcatct
cagagaggcaacagcgttaattcagatctcttcatcccaaacaacaccctgccaacctac
gagcaactgaccgtgccggaaagaaatgaagacgatatatcctga

DBGET integrated database retrieval system