KEGG   Gallus gallus (chicken): 101750560
Entry
101750560         CDS       T01006                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04210  Apoptosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04620  Toll-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04910  Insulin signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04920  Adipocytokine signaling pathway
gga05132  Salmonella infection
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101750560
   04012 ErbB signaling pathway
    101750560
   04370 VEGF signaling pathway
    101750560
   04371 Apelin signaling pathway
    101750560
   04068 FoxO signaling pathway
    101750560
   04150 mTOR signaling pathway
    101750560
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101750560
  09143 Cell growth and death
   04210 Apoptosis
    101750560
   04218 Cellular senescence
    101750560
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101750560
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101750560
   04625 C-type lectin receptor signaling pathway
    101750560
  09152 Endocrine system
   04910 Insulin signaling pathway
    101750560
   04920 Adipocytokine signaling pathway
    101750560
   04914 Progesterone-mediated oocyte maturation
    101750560
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101750560
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    101750560
   05168 Herpes simplex virus 1 infection
    101750560
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101750560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    101750560
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101750560
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101750560
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 ABC1
Other DBs
NCBI-GeneID: 101750560
NCBI-ProteinID: XP_025000271
CGNC: 70008
Position
32
AA seq 482 aa
MSEVAVVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPDSPDSASPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPEEREEWMRAIQTVANSLKEQQQPGGDG
GDCKCGTPGDNSGAEEMEVAVSKSRAKATMNDFDYLKLLGKGTFGKVILVREKATGRYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTSDRLCFVMEYANGGELFF
HLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKE
GISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPRTLSPEAKALLAGLLKKDPKQRLGGGPTDAQEVMEHRFFAAINWQDVVH
RKLVPPFRPQVTSEIDTRYFDDEFTAQSITITPPDRYDDVDALDGDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgagcgaagtggccgtggtgaaggagggctggctgcacaagaggggggaatacatcaag
acgtggcggccccgctatttcctgctgaagagcgacgggtccttcattggctacaaggag
cgccccgacagccccgacagcgcctcgccgcccctcaacaacttctcggtggcggagtgc
cagctgatgaagacggagcgcccgcggcccaacacgttcgtcatccgctgcctgcaatgg
acgacggtcatcgagaggaccttccacgtggattccccggaggagcgggaggagtggatg
agggcgattcagacggtggccaacagcctgaaggagcagcagcagccggggggggacggg
ggggactgcaaatgtgggacccccggggacaacagcggggcggaggagatggaggtcgcc
gtgagcaagagccgggccaaggcgacgatgaacgatttcgactacctgaagctgttgggg
aagggaacgtttgggaaggtgatcctggtgagggaaaaggccacggggcggtactacgcc
atgaagatcctccgcaaggaggtcatcatcgccaaggacgaggtcgcgcacaccgtcacc
gagagccgcgtgctgcagaacacccggcaccccttcctgacggccctgaaatacgccttc
cagaccagcgaccgcctctgcttcgttatggaatacgccaacggcggcgagctctttttc
cacctctcccgggagcgcgtcttcacggaggagcgcgcgcggttctatggggctgagatc
gtctctgccctggagtacctccactcccgggacgtggtgtaccgcgacatcaagctggag
aatctgatgctggataaggacgggcacattaagatcaccgactttgggctctgcaaagag
ggcatcagcgatggggccaccatgaagaccttctgtgggacccccgagtacctggcgccc
gaagtgctggaggacaacgactacgggcgcgcagtggactggtggggcctcggggtggtg
atgtatgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttc
gagctcatcctgatggaggagatccgcttcccccgcaccctcagccccgaggccaaagcg
ctgctggccgggctgctcaaaaaggaccccaagcagaggctgggcggcggccccacggac
gcgcaggaggtgatggagcaccgcttcttcgccgccatcaactggcaggacgtggtgcac
aggaagctcgtgccccccttccggcctcaggtgacctcagagatcgacacgcggtacttt
gacgacgaattcacggcgcagtccatcaccatcaccccgcccgaccgctatgacgacgtg
gacgccctggacggcgatcagcgcacgcacttcccccagttctcatactctgccagcatc
cgggagtga

KEGG   Gallus gallus (chicken): 395928
Entry
395928            CDS       T01006                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04210  Apoptosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04620  Toll-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04910  Insulin signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04920  Adipocytokine signaling pathway
gga05132  Salmonella infection
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395928 (AKT1)
   04012 ErbB signaling pathway
    395928 (AKT1)
   04370 VEGF signaling pathway
    395928 (AKT1)
   04371 Apelin signaling pathway
    395928 (AKT1)
   04068 FoxO signaling pathway
    395928 (AKT1)
   04150 mTOR signaling pathway
    395928 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    395928 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    395928 (AKT1)
   04218 Cellular senescence
    395928 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395928 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    395928 (AKT1)
   04625 C-type lectin receptor signaling pathway
    395928 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    395928 (AKT1)
   04920 Adipocytokine signaling pathway
    395928 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    395928 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395928 (AKT1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    395928 (AKT1)
   05168 Herpes simplex virus 1 infection
    395928 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    395928 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395928 (AKT1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     395928 (AKT1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   395928 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 395928
NCBI-ProteinID: NP_990386
CGNC: 49557
Ensembl: ENSGALG00000011620
UniProt: O57513
Position
5
AA seq 480 aa
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEMMDF
RSGSPSDNSGAEEMEVSMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYGKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCVDNERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagtagcgatagtgaaggaaggatggctccacaaacgaggagaatatatcaaa
acatggaggccacggtattttcttttaaagaatgatggcacattcattggctacaaggaa
cgaccgcaagacgttgaccaacgagaatcacctttaaataacttctcagtagctcagtgc
cagctgatgaagacagaacgacctaaaccaaacacatttatcattagatgcctccagtgg
accacagtaattgaaagaacatttcatgtggagactccagaggagcgggaagaatggaca
aaagctatccaaactgttgcagacagcctcaagaaacaggaggaagagatgatggatttt
agatctggttctcctagtgataattcaggtgctgaagaaatggaagtttctatgacaaag
ccaaaacacaaagtgaccatgaatgaatttgaataccttaagctactgggaaaaggcact
tttggaaaggtcattttagttaaagaaaaagcaaccggacggtattatgctatgaaaatt
ctgaagaaggaagttattgtagcaaaggatgaagtagcacacacgctgacagaaaaccgt
gttttacagaactcacggcatccattcttaacagctttaaagtattcctttcagacacac
gatcgcttgtgttttgttatggagtatgctaacggaggggagttgtttttccatctgtcg
agagagcgtgtattttctgaagaccgggcgcgtttttatggggctgagattgtttcagcg
ctggattacctgcattcagagaagaatgtggtgtacagagatttgaagctggaaaatctt
atgctggataaagacgggcacataaaaattacagactttggactatgtaaagaaggcata
aaagatggagcaacaatgaagactttctgtggcactccagagtatcttgcaccagaggtg
ctggaggataatgactatggtcgtgcagtggactggtggggattaggagttgtgatgtat
gaaatgatgtgtggccggctccctttctacaatcaggaccatgaaaagctctttgaactc
atccttatggaagagattagatttccacgcactttgtcacctgaagcaaaatctctcttg
tcaggtttgctgaagaaagatcctaagcaaaggttaggaggcggtcctgatgatgccaag
gagattatgcagcacaaattctttgctggcattgtttggcaagatgtatacgggaagaag
cttgtacctccatttaagccacaagttacatctgaaacagatacaagatactttgatgaa
gaatttacagcacagatgattacaatcactcctcctgaccaagatgacagcatggattgt
gtagacaatgagagaagacctcattttcctcagttctcctattcagccagtggaaccgct
taa

KEGG   Gallus gallus (chicken): 421497
Entry
421497            CDS       T01006                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04210  Apoptosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04620  Toll-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04910  Insulin signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04920  Adipocytokine signaling pathway
gga05132  Salmonella infection
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    421497 (AKT3)
   04012 ErbB signaling pathway
    421497 (AKT3)
   04370 VEGF signaling pathway
    421497 (AKT3)
   04371 Apelin signaling pathway
    421497 (AKT3)
   04068 FoxO signaling pathway
    421497 (AKT3)
   04150 mTOR signaling pathway
    421497 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    421497 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    421497 (AKT3)
   04218 Cellular senescence
    421497 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    421497 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    421497 (AKT3)
   04625 C-type lectin receptor signaling pathway
    421497 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    421497 (AKT3)
   04920 Adipocytokine signaling pathway
    421497 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    421497 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    421497 (AKT3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    421497 (AKT3)
   05168 Herpes simplex virus 1 infection
    421497 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    421497 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    421497 (AKT3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     421497 (AKT3)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   421497 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C ABC1 PH_11
Other DBs
NCBI-GeneID: 421497
NCBI-ProteinID: XP_015139467
CGNC: 8138
Ensembl: ENSGALG00000034081
UniProt: A0A1D5NTY9
Position
3
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaggaaggctgggttcagaagaggggagaatatataaaa
aactggcggccaagatatttcctgctaaagacagatggttctttcataggctataaggag
aagccccaggatgtggatctgccatatccactcaacaacttttcagtggcaaaatgtcag
ctaatgaaaacagagcgaccaaagccaaacacattcattatcagatgtcttcagtggacc
actgtcatagagaggacgttccacgtagacactccagaggaacgggaagaatggacagaa
gcaatccaggctgtagcagacagacttcagaggcaggaagaggaaaggatgaactgtagt
ccaacttcacagatagacaatataggtgaagaagagatggatgcttcaacgactcatcat
aaaagaaagacaatgaatgactttgactatttaaaactactgggcaaaggcacgtttggc
aaagttatcttggtccgagagaaggctagtgggaaatactatgctatgaagattttgaaa
aaagaagtcattattgcaaaggatgaagtggctcatacacttacggaaagcagagtattg
aaaaacaccagacatccttttttaacatccttgaaatattccttccagacaaaggatcgt
ttgtgttttgtgatggagtatgttaatggaggagagctgtttttccatttgtcgagagag
cgggtgttctcagaggaccgcacacgcttctatggtgcagaaattgtctcagctctggac
tatctgcattctgggaagattgtgtaccgtgatctcaagttagaaaatctaatgttggat
aaagatgggcatataaagattacagattttggactttgcaaagaaggaatcacagatgca
gcaactatgaaaacattctgtggtactccagaatacctggcgcctgaggtgttggaagat
aatgactatggtcgtgcagtggactggtggggattaggagttgtcatgtatgaaatgatg
tgtggaagattgcctttctacaaccaagatcacgagaaactatttgaactgatactaatg
gaggacataaaatttcctcgaactctatctgcagatgcaaaatcattactttcaggccta
ctgataaaagatccaaataagcgacttggtggaggcccagatgatgcaaaagaaatcatg
cgtcatagtttctttgctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtgacgtctgagacagacaccaggtattttgatgaagaatttaca
gctcagactattacaataacgccgcctgaaaaatatgacgaggatggtatggactgcatg
gacaatgagaggcggccgcatttcccccagttttcctactctgcaagtggaagagaataa

DBGET integrated database retrieval system