KEGG   Gallus gallus (chicken): 101750705
Entry
101750705         CDS       T01006                                 

Gene name
ADRB1
Definition
(RefSeq) beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
gga04540  Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101750705 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101750705 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101750705 (ADRB1)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101750705 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    101750705 (ADRB1)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    101750705 (ADRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4 DUF1180 S_4TM Saf_2TM
Other DBs
NCBI-GeneID: 101750705
NCBI-ProteinID: XP_015144447
CGNC: 53529
Position
6
AA seq 477 aa
MGDGWLPPDCGPHNRSGGGGATAAPTGNRQVSAELLSQQWEAGMSLLMALVVLLIVAGNV
LVIAAIGRTQRLQTLTNLFITSLACADLVMGLLVVPFGATLVVRGTWLWGSFLCECWTSV
DVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKGIICTVWAISALVSFLPIMMH
WWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVYLRVYREAKEQIRK
IDRCEGRFYGSQEQPQPPPLPHQQPILGNGRASKRKTSRVMAMREHKALKTLGIIMGVFT
LCWLPFFLVNVVNVFNRDLVPDWLFVFFNWLGYANSAFNPIIYCRSPDFRKAFKRLLCFP
RKADRRLHAGGQPAPLPGGFISTLGSPEHSPGGMWSDCNGGMQGGSESSLEERHSKTSRS
ESKMDREKNTLATTRSYCTFLGSGNKAVFCTVLRIVKLFEDATCTCPHTQIKSEMEV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggagatgggtggctgccgcccgactgcggcccccacaaccgctccggaggcggcggg
gcgacggcggcgccgaccgggaaccgtcaggtgtccgccgaactgctgtcgcagcagtgg
gaggcgggcatgagcctgctgatggccctggtggtgctgctcatcgtggccggcaacgtg
ctggtgatcgcggccatcgggcgcacgcagcggctgcagacgctcaccaacctcttcatc
acctcgctggcctgcgccgacctggtgatggggctgctggtggtgcccttcggggccacg
ctggtggtgcggggcacctggctgtggggctccttcctctgcgagtgttggacgtcggtg
gacgtgctctgcgtgacggccagcatcgagaccttgtgcgtcatcgccatcgaccgctac
ctggccatcacttcgcctttccgctaccagagcctgatgaccagggctcgggccaagggc
atcatctgcaccgtctgggccatctccgccctggtctctttcctgcccatcatgatgcac
tggtggcgggacgaggaccctcaggcactcaagtgctaccaggacccgggctgctgcgac
ttcgtcaccaaccgggcttacgccatcgcttcgtccatcatctccttctacatccccctc
ctcatcatgatcttcgtgtacctgcgggtgtaccgggaggccaaggagcagatcaggaag
atcgaccgctgcgagggccggttctatggcagccaggagcagccgcagccacccccgctc
ccccaccaacagcccatcctcggcaacggccgcgccagcaagaggaagacgtcccgtgtc
atggccatgagggagcacaaagctctgaagacattgggtatcatcatgggggtgttcacc
ctctgctggctccctttcttcttggtgaacgttgtcaacgtcttcaacagagacctggtg
ccggactggctctttgttttcttcaactggttgggctacgccaactccgctttcaacccc
atcatctactgccgcagcccggacttccgtaaggccttcaagaggctgctctgcttcccc
cgcaaagctgacaggcgactgcacgctggcggccaacccgccccgctgcccgggggcttc
atcagcaccctgggctcccctgagcacagcccaggggggatgtggtctgactgcaacggg
ggcatgcagggtggcagtgagtcgagcctggaggagagacatagcaaaacatcccgctcg
gagtccaagatggacagggaaaaaaacaccctggcaacaacaagatcttactgcacattt
ttggggagcggcaacaaagctgttttttgcacagtattaaggattgtaaagttatttgaa
gatgctacttgcacatgtccacacacgcaaattaaaagtgaaatggaggtttaa

DBGET integrated database retrieval system