KEGG   Gallus gallus (chicken): 107049452
Entry
107049452         CDS       T01006                                 

Gene name
STX5
Definition
(RefSeq) LOW QUALITY PROTEIN: syntaxin-5
  KO
K08490  syntaxin 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107049452 (STX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    107049452 (STX5)
Membrane trafficking [BR:gga04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    107049452 (STX5)
SSDB
Motif
Pfam: SNARE Syntaxin-5_N Syntaxin ATG17_like DUF5063 DUF16 SKA1 Vac_Fusion BLOC1_2 Spectrin
Other DBs
NCBI-GeneID: 107049452
NCBI-ProteinID: XP_025001466
CGNC: 72471
Position
33
AA seq 295 aa
MSCRDRTAEFLSACKSLQGRQNGIQSHRATRQRSEFSLMAKXGGTHWKDLSNTFAKLEKL
TIRDGQRKSLFDDKAVEIEELTYIIKQDIGGLNQQIARLQEVVRARGGPGGRHQQSHSNS
VVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREHFSRAPPAPPHLGMGAAGLPPQNRS
PDAVSIEMDPRTTQQLQLLDEQDSYIQSRADAMQNIEATIVELGSIFQQLAHMVKEQEDT
IQRIDAGVDEAQLHVEAAHTELLRYFRGVTSQRWLLLKAFLLLLLFFIIFVVFLA
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcgtgtcgcgaccgcaccgctgagttcctctctgcctgcaaatcactgcagggccga
cagaatgggattcaaagccacagagccacgcggcagcgcagcgagttcagcctcatggcc
aagtgaggggggacgcattggaaggacctcagcaacaccttcgctaaactggagaagctg
acgatccgtgatggccaacgcaaatccctctttgacgacaaagcggtggagatcgaggag
ctcacctacatcatcaaacaggacatcggagggctgaaccaacagatcgcgaggctgcag
gaggtggtgagggcgaggggggggcccggagggaggcaccagcagagccactccaacagc
gtcgtcgtctccttgcagtccaaactcgcctccatgtccaatgacttcaaatcggtgctg
gaggtgcgcacagagaacctgaagcagcagcggagccgcagagagcatttctcccgcgcc
ccccccgcccccccccacctgggcatgggtgctgcaggactccccccccaaaatcgctcc
cccgacgccgtcagcatcgagatggacccccgcaccacccaacagctgcagctgctggat
gagcaggattcgtacatccagagccgtgcggacgccatgcagaacattgaggccaccatc
gtggagctgggctccatcttccagcagctggcacacatggtgaaggagcaggaggacacc
atacagaggatcgacgccggtgtggacgaggcgcagctgcacgtggaggcggcgcacacg
gagctgctgcggtacttccggggcgtcacctcgcagcgatggctgctgctcaaagccttc
ctcctcctcctcctcttcttcatcatcttcgttgtcttcctcgcctga

DBGET integrated database retrieval system