KEGG   Gallus gallus (chicken): 107050028
Entry
107050028         CDS       T01006                                 

Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107050028
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107050028
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107050028
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107050028
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107050028
   04914 Progesterone-mediated oocyte maturation
    107050028
   04916 Melanogenesis
    107050028
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107050028
   04270 Vascular smooth muscle contraction
    107050028
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107050028
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD GBR2_CC
Other DBs
NCBI-GeneID: 107050028
NCBI-ProteinID: XP_025001455
CGNC: 73043
Position
33
AA seq 1196 aa
MSLPRVCPHRALRPRLPRSTGPPRAGPGRTAPHRRCAFKAATGSARERIRAEGGAGRCGR
TGTGDGDRDGADGRVAEGRCGAGACRGSAPSWPPKRTTGRRRGGPQRPQTAAPPRRALRP
PPPRRPPGTSAGGRRSGGGRRGSPRPTAPLRAPRLFRSRRFPSLKLELLYQRYFAQLDRR
RLAVLLGLQALLCALLLALHCAPGAPNAAVAAALSAAAAAAALLAVLCGRGAFPREAVRA
LSYAALGLLAAVPLLGAAAVAPRGAAEGVWWGVLCIYAAYALLPVRMRAAVLAGALLAAL
QLGVTWHLCADEPLLWRQLSANALIFLCTNVVGVCTHYPAEVAQRKAFQETRGYIQARLH
LQRENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARGDHAHCCVEM
GVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITWATLQCLNGDYEVEPGNGGERNAYLKEHNIETFLVVGCSQSASEEKALLAKLQ
RSHAGSAEALVPRWVPERSFSRPKDCKAFRQMGIDDSTKDNRGAQEPLNPEDEVDEFLGR
AIDARSIDQLRKDHVRRFLLTFQSPELERKYSKKVDNRFGGYVGCALLVFCFICCVQLII
FPLSPLMIGAYIGAFLLLSSILFICAVHSCINLFPPVLQRLSRSIVRSRSRSTATAVLVV
IIVFITAFINMFSCSRVPLRDCAARALNVSPTAVGPCELRALNISLGAPPGLCRPQGGGC
DFPEYVTLSVVLSLLAAAAFLQLSSAGKLLLGAALGGAYLALAEGPHAALFDNADLLLLA
HALPSFNATQGECPVEGKVALRYVTPVVLGVFALALYLHAQQVESTARLDFLWKLQATGE
KEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYV
ELEANNEGVECLRLLNEIIADFDEIISEQKYRQLEKIKTIGSTYMAASGLNAATYDREGR
SHIAALADYAMQLMEQMKYINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNV
SSRMDSTGVPDRIQVTTDLYQVLAAKGYVLECRGVVKVKGKGEMTTYFLNAGPGGS
NT seq 3591 nt   +upstreamnt  +downstreamnt
atgtcactcccgcgcgtgtgcccgcaccgagcgctccgcccgcgcctcccccgcagcacc
ggacccccccgcgccggaccgggccgcaccgcaccgcaccgccgctgcgcctttaaggcc
gcgaccgggagcgcccgggagaggatccgggcggagggcggtgcggggcggtgcgggcgg
accgggaccggcgatggggatcgcgatggggcggacggccgcgtagcagaggggcggtgc
ggggccggagcatgtcgtggttcagcgccctcctggcccccaaagcggacgaccggaaga
cggcgtgggggaccgcaacggccccaaaccgccgccccgccccgccgcgctctgcggccg
cctccgccgcgacgccccccggggacctccgcgggcggacggcggagcggcggaggacgg
cgcggatccccccggccgacggcgccgctccgcgccccgcggctgttccgctcccggcgt
ttcccgtcgctcaaactggagctgctctaccagcgctacttcgctcagctcgaccggcgc
cgcctggcggtgctgctggggctgcaggcgctgctgtgcgctctgctgctggcgctgcac
tgcgcgcccggcgcccccaacgcggcggtggcggcggcgctgagcgcggcggcggcggcg
gcggcgctgctggcggtgctgtgcgggcggggcgcgttcccgcgggaggcggtgcgcgct
ctgagctacgcggctctggggctgctggcggcggtgccgctgctgggagcggccgcggtg
gccccgcgcggggcggcggagggcgtttggtggggcgtgctctgcatctacgccgcctac
gcgctgctgcccgtgcgcatgcgcgccgccgtgctggccggggcgctgctggccgcgctg
cagctcggcgtcacgtggcatctgtgcgccgacgagccgctgctgtggcggcagctcagc
gccaacgccctcatcttcctctgcaccaacgtggtgggggtctgcacccattaccctgcg
gaggtggcgcagcgaaaagccttccaggagacccgtgggtacatccaggcacggctgcac
ctccagagggagaaccggcagcaggagcggctgctgctgtcggtgctgccccaacacgtg
gccatggagatgaaggaggacatcaacaccaagaaggaggacatgatgttccacaagatc
tacatccagaagcacgacaacgtcagcatcctcttcgctgacatcgagggcttcaccagc
ctggcgtcccaatgcacggcgcaggagttggtgatgacgctcaatgagctcttcgcacgc
ttcgacaagctggcggcggagaaccactgtctgcgcattaagatcctgggcgactgctac
tactgcgtgtcggggctgccggaggcgcggggggaccacgcgcactgctgcgtggagatg
ggggtggatatgattgaggccatctcgttggtgcgcgaggtgacgggtgtgaacgtgaat
atgcgcgtggggatccacagcggccgcgtgcactgcggggtgttggggctgcgcaaatgg
cagttcgacgtgtggtccaacgacgtcactttggccaaccacatggaggcggggggcaaa
gcggggcggatccacatcacgtgggcgacgctgcagtgcctgaatggggactacgaggtg
gagccgggaaacggcggggagcggaacgcgtatctgaaggagcacaacatcgaaacgttc
ctcgtcgtgggatgcagccaaagcgcgtcagaggagaaggctctgctggcgaagctgcag
cgcagccacgcgggctcagcggaggctttggttccacgttgggtccccgagcgctccttc
agccgccccaaagactgcaaagcgttccggcagatgggcatcgatgactccaccaaggac
aaccgcggtgcccaggagccgctcaaccccgaggatgaggtggatgagttcctgggccgc
gccatcgacgcgcgcagcatcgatcagctgcggaaggaccacgtgcggcgcttcctgctc
accttccagagccccgagctggagaggaagtactccaagaaggtcgataaccgctttggg
ggttacgtgggctgcgctctgctcgtcttctgcttcatctgctgcgtgcagctcatcatc
ttccccctctccccgctgatgatcggtgcctacatcggagccttcctcctcctctcctcc
atcctcttcatctgcgccgtgcattcgtgcatcaacctgttccccccggtgctgcagcgc
ctctcccgctccatcgtccgctcccggtcccgcagcaccgccaccgccgtcctcgtcgtc
atcatcgtcttcatcaccgccttcatcaacatgttctcctgcagtcgggtaccgctgcgg
gactgcgctgcgcgcgccctcaatgtcagccccacagctgtggggccgtgtgagctgcgc
gccctcaacatctccctgggggcccccccggggctgtgccggccgcagggggggggctgc
gacttccctgagtacgtgacgctcagcgtggtgctcagcctcctggcggccgccgccttc
ctgcagctgagcagcgccgggaagctgctgctgggggcggcgctggggggcgcatacctg
gcgctggcggagggaccccacgcggcgctcttcgacaacgccgatctgctgctgttggcg
cacgcgctaccctccttcaacgccacccagggggaatgcccggtggaggggaaggtggct
ctgcgttacgtcacccccgtggtgttgggggtcttcgccctggcgctgtacctccacgca
cagcaggtggagtccaccgcgcgcctcgacttcctctggaagctgcaggcgacgggcgag
aaggaggagatggaggagctgcaggcgtacaaccggcggctgctgcacaacatcctcccc
aaagacgtggctgcgcatttcctggcgcgggagcggcgcaacgatgagctctactaccag
tcctgtgagtgcgtggccgttatgttcgcctccatcagcaacttctccgagttctacgtg
gagttggaggccaacaatgagggcgtggagtgcctgcggctgctcaacgagatcatcgcc
gacttcgatgagatcatcagcgagcagaaataccggcagctggagaagatcaaaaccatc
ggcagcacttacatggcagcctcggggctcaacgccgccacctacgaccgcgagggccgc
agccacatcgccgcgctggccgactacgccatgcagctgatggagcagatgaagtacatc
aacgagcactccttcaacaacttccagatgaagatcggtctcaacatgggcccggtggtg
gcgggggtgatcggggcacgcaaaccccaatacgacatttggggcaacaccgtcaacgtc
tccagccggatggacagcaccggcgtgcccgaccgcatccaggtgaccacagacctgtac
caggtgctggcagccaagggctacgtgctggagtgccgcggggtggtgaaggtcaaaggc
aaaggggagatgaccacctacttcctgaacgccggccctgggggcagttag

KEGG   Gallus gallus (chicken): 395339
Entry
395339            CDS       T01006                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    395339 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395339 (ADCY9)
   04020 Calcium signaling pathway
    395339 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    395339 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    395339 (ADCY9)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395339 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    395339 (ADCY9)
   04916 Melanogenesis
    395339 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395339 (ADCY9)
   04270 Vascular smooth muscle contraction
    395339 (ADCY9)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     395339 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 AC_N
Other DBs
NCBI-GeneID: 395339
NCBI-ProteinID: NP_989961
CGNC: 5882
Ensembl: ENSGALG00000007779
UniProt: F1NP57
Position
14
AA seq 1346 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVTVRINPRQQQGCSSAKRCKYSISSSCSSGESG
GARRAGGGGGPGLRRQKKLPQLFERASSRWWDPKFDSTNLEEACMERCFPQTQRRFRYAL
FYIGSACLLWGIYFGVHMREKQMVFMVPALCFLLVCVAFFAFTFTKAYARRYVWTSLTLT
LLVFALTLAPQFQALDPLSGSGDASNRTAPAAPVDTCLSQVGSFSMCVEVLLLLYTVMHL
PLYLSLFLGLSYSVLFETFGYRFRDESCFTPLGGGAVYWELLSKAFLHVCIHAIGIHLFI
MSEVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDDESENSIKR
HSTSSPKNRKKKPSIQKTPIIFRPFKMQQIEQVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEDTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERVGQSVVADQLKGLKTYLISGQKVKEPHCSCSQALLPSLEAGDGARMQ
AAPSAENAADSTKALKHVEKPKPCPSCSTTLVPPCDVSIDEGAIQNGCQDEHKNSTKAPG
GHSPKTQNGLLSPPQEEKLSNSQTSLYEMLQEKGRWGGVSLDQSALLPLRFKNIREKTDA
HFVDVIKEDSLMKDYFFKPPISKLSLNFLDQDLEMAYRTSYQEEVMRNAPVKTFASATFS
SLLDVFLSTTVFLILSVTCFLKHGMVASPPPPAAVVVFVIAILLEVLSLVISVRMVFFLE
EVMACTKRLLELISGWLPRHFLGAILVSLPALAVFSHFTSDFETNIHYTMFMCCAILIAI
VQYCNFCQLSSWMRSLLATVVGAVLLILLYVSLCPDSSVETLHLDLAQNLSSRKSPCNSS
MPADVKRPADLIGQEVILVVFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRD
QADWLLRNIIPYHVAEQLKVSQSYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLN
ELIGDFDELLSKPHYSSIEKIKTIGATYMAASGLNTSQCQDSNHPHGHLQTLFEFAKEMM
RVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRI
QVSEESYRILSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMDNGIVPHHQLSISPDIRVQV
DGSIGRSPTDEIANLVPSVQNSDKTAHGTDNSETKDALPSSKKLQKEPTKAEERCRFGKA
VEKTDCEEAGTEEVNELTKLNVSKSV
NT seq 4041 nt   +upstreamnt  +downstreamnt
atggcttccccgccgcaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgacggtgaggatcaacccccggcagcagcagggctgc
tcctcggccaagcgctgcaagtacagcatctcgtccagctgcagctccggggagtcgggg
ggcgcccggcgggcgggcggaggcggcgggcccggcctgcgccggcagaagaagctgccg
cagctcttcgagagggcctcgtcccgctggtgggaccccaagttcgactccaccaacctg
gaggaggcgtgcatggagcgctgcttcccgcagacccagcgccgcttccgctacgccctc
ttctacatcggctcggcctgcctgctctggggcatctacttcggcgtgcacatgagggag
aagcagatggtgttcatggtgccggccctgtgcttcctcttggtgtgcgtggccttcttc
gccttcacgttcaccaaggcctacgcccgccgttacgtgtggacgtcgctgacgctcacg
ctcctggtgttcgccctgacgttggccccgcagttccaggccctggatcccctctcgggg
agcggcgacgcgtccaaccgcacggccccggccgctccggtcgacacgtgcctgtcgcag
gtgggcagcttctccatgtgcgtcgaggtgctcctgttgctctacacggtgatgcactta
cccctgtatttaagcttgtttctgggactgtcctactcggtcctctttgagaccttcggc
tatcgcttccgcgatgagagctgcttcacgccgctcggaggcggcgcggtttactgggag
ctgttgagcaaagccttccttcacgtctgcatccacgccattggcatccacttatttatc
atgtccgaagtcaggtccagaagcacgttcctgaaggtggggcagtccatcatgcacggg
aaggacttggaagtggaaaaagccctgaaagagaggatgattcactctgttatgcccaga
ataatagcagacgacttaatgaaacagggcgacgacgagagcgagaactccatcaaacgc
cattccacctcgagccccaagaacaggaagaagaagccctccatccagaaaacccccatc
atattccggcccttcaaaatgcagcagatagagcaggtgagcattctgttcgcggacatc
gttggcttcactaagatgagcgccaataaatctgcccacgcgctggtggggctcctcaac
gacctctttgggcgcttcgaccgcctgtgcgaggacaccaagtgtgagaagatcagcacg
ctgggggactgctactactgcgtggccggctgcccggagccacgggcggaccacgcttac
tgctgcatcgagatgggcttgggcatgatcaaagccatcgagcagttttgccaggagaag
aaagaaatggtcaacatgagagtgggcgtccacaccgggacggtgctgtgcggcatcctg
gggatgaggaggttcaagttcgacgtgtggtccaacgacgtcaacttggccaatctgatg
gagcagctgggggtggctgggaaagtccatatttcggaagctaccgccaagtatttggac
gaccgttacgaaatggaggatggcaaagtgacggagcgggtcggccagagcgtggtggct
gaccagttaaaaggactgaagacctatctgatctctggtcagaaggtgaaggagccccac
tgcagctgttcgcaagccttgcttcccagcttggaggctggggatggagccaggatgcag
gcagctccctcggccgagaacgccgctgactccacgaaggctctcaaacacgtggaaaag
ccaaagccttgcccttcatgtagtaccacccttgttcccccctgcgatgtcagcatagac
gaaggagctatccaaaatggttgtcaggatgagcataaaaacagtacgaaggctccagga
ggacacagcccaaagactcagaatggacttttgagtcctccgcaggaggaaaagctgagc
aacagtcaaacctcgctttatgaaatgttgcaagagaaaggaagatgggggggagtgagt
ctggatcagtcggctctcctccctttgaggttcaagaacatcagagaaaagacagatgcc
cactttgtggatgtgattaaagaggacagcctcatgaaggactacttctttaaaccacct
atcagcaagctgagcctgaacttcttggatcaggatctggagatggcctacaggacgagc
tatcaggaagaggtgatgaggaacgcacccgtgaagacgtttgccagcgctaccttcagc
tccctcctggacgtgttcctctccaccacagtcttcctcatcctctccgtcacgtgtttc
ctgaagcatggcatggtggcatcccctcctccccctgctgctgtcgtggtgttcgtcatc
gccatcctgctggaggtgctgtccctcgtcatctcagtcaggatggtgttcttcctggag
gaggtgatggcttgcacgaagcgcctcctggagctgatctccggctggctgccgcggcat
ttcctcggtgccatcctggtgtctctcccagctcttgcagttttttcacacttcacctct
gattttgaaacaaacatacattacaccatgtttatgtgctgtgccattctgatcgccatt
gtgcagtactgcaacttctgccagcttagctcctggatgagatctctgttggcaaccgta
gtaggagcagtgcttctcattctgctctacgtctccttgtgtccggacagctctgtggaa
accttgcatctagacttggcacagaaccttagctccaggaagagtccgtgcaacagttcg
atgccggccgacgtgaagaggcccgcagacctgataggtcaggaagtgattttggtggtc
ttcctcctgctgctcctggtctggttcctgaaccgcgagttcgaggtcagttaccgcctg
cactaccacggggacgtggaggctgaccttcatcgcaccaagattcagagcatgagggat
caagccgactggctgctgaggaacattatcccctaccatgtggccgagcagctgaaggtt
tcccagagctattccaaaaaccacgacagcggcggagtcatctttgccagcattgtgaac
ttcagcgagttctacgaagagaactacgaaggaggcaaagagtgctacagagtcctgaat
gaactgataggggatttcgatgagctgctgagcaaacctcattacagcagcattgagaaa
atcaaaaccatcggggcgacctacatggctgcttcgggactgaacacgtcgcagtgccag
gacagcaaccatccccacggacatttgcagaccctttttgaatttgccaaagaaatgatg
cgagtggtggatgacttcaacaacaacatgctgtggtttaactttaaacttcggattggc
tttaaccacggccccctgactgcgggggtcatcggcaccaccaagttgctgtacgacatt
tggggtgacactgtgaacattgcgagcagaatggacaccacgggcgtcgagtgtcgcata
caggtgagtgaggagagctaccgcatcctgagcaagatggggtatgactttgactacagg
gggacggtcaatgtgaaggggaagggtcagatgaagacctacctgtaccccaagtgcatg
gacaacgggattgtgccccatcaccagttgtccatatctccagacattcgggttcaggtg
gacggcagcattgggcggtctcccaccgatgagattgccaacctggtgccttctgtacag
aattctgataagacagcccacggcacagataactcagaaaccaaggatgctcttccttcc
tccaagaagctccagaaagagccgacgaaagcagaagagaggtgcaggtttggcaaagct
gtagagaagactgactgtgaggaagcgggaactgaggaggtcaatgaactgacaaagcta
aatgtctctaagagtgtatga

KEGG   Gallus gallus (chicken): 395340
Entry
395340            CDS       T01006                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    395340 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395340 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    395340 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    395340 (ADCY5)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395340 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    395340 (ADCY5)
   04916 Melanogenesis
    395340 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395340 (ADCY5)
   04270 Vascular smooth muscle contraction
    395340 (ADCY5)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     395340 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD GBR2_CC
Other DBs
NCBI-GeneID: 395340
NCBI-ProteinID: NP_989962
CGNC: 8892
Ensembl: ENSGALG00000031244
UniProt: A0A1D5P0J0
Position
7
AA seq 1217 aa
MSRSNSVSPPGFGGPAPWAATEQHRSAWGEAEARANGYSYPPPPNRSSGKKASRMASRWR
SEEDYEPQASRSRGESGCKMMMSFRSKSAWQEHGDESRRHRSRHPPGGDSPAAPNNASPR
EQGEVRPRSVELGLEEKRIKAKIEELEEDDGDDGDSEVAFSMGSCCSSLLQIFRSKKFQS
EKLERLYQRYFFRLNQSSLTMLMAVLVLVCVVMLIFHAVHGHYEVSYVVVLSLAILLMVV
LCMVCNRNDFHQDHMWLACYSVILVILAVQVVGVLLVWPRSASEGIWWTVFFIYSIYTLL
PVRMRAAVISGVVLSAIHLAVSLKINAEDKFLLKQLVSNVLIFSCTNIVGVCTHYPAEVS
QRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQ
KHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCV
SGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFD
VWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYEVELGFGGERNAYLKEHSIETFLIV
RCSQKRKDEKATIAKMNRQRTNSISHNPPHWGVDRPFYNHLGAHQVSKEMKRMGFEDPKD
KNTQESMNPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGA
YVACASLVFLFICFVQIIIVPHSTFMLGFYLTCFLILTTVVFVSIIYSCVKLFPAPLQTL
SKKIVQSRTNSTLVGVFAIILVFLSAFVNMFMCSTVDLASCMAAEYNITPDRVDICLISN
LTSNYSLGTLQGFCDSPLPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLILMLIIEFIY
VLIVEVPGVNLFDNADLLVTANTYMSTNSTLPCSPAMTRVALKIVTPVIITVFVLALYLH
AQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLAQERRNDELYY
QSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDQFRQLEKIKT
IGSTYMAASGLNDSTYDKEGKTHIKALADFAMRLMDQMKYINEHSFNNFQMKIGLNIGPV
VAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANNYQLEYRGVIKVK
GKGEMTTYFLNEGPPIS
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtcccggtccaacagcgtcagccccccgggcttcggcggccccgcgccctgggcggcc
actgagcagcaccgctcggcctggggcgaggcggaggcgcgggccaatggctactcctac
ccgccgcctcccaacaggtcctcgggcaagaaggcctcccgcatggcgagcaggtggcgg
agcgaggaagactacgagccccaggcgagccggagccgcggggagagcggctgcaagatg
atgatgagctttaggtccaaatctgcctggcaggagcacggtgacgaaagccgacgtcac
cggtcccgccacccgcccggcggtgattcccccgctgcccccaacaatgccagcccccgg
gagcagggggaggtacggccccgctcggtggagttggggctggaggagaaacgcatcaag
gccaagatcgaggagctggaggaggacgacggggacgacggggactccgaggtggccttc
tccatgggcagctgttgcagcagcctgctgcagatcttcaggtccaagaagttccagtcg
gagaaactggagcgcctctatcagcgctacttcttccgactcaaccagagcagcctcacc
atgctcatggccgtgctggtgctggtctgtgtggtcatgctgatcttccacgccgtacac
ggccactacgaggtgtcctacgtcgtggtgctctccctggccatcctgctgatggtggtg
ctgtgcatggtgtgcaaccgcaacgacttccaccaggaccacatgtggctagcgtgctac
tccgtcatcctggtgatcctggctgtgcaggtggtaggggttctgctggtctggcccagg
agcgcctcggagggcatctggtggaccgtcttcttcatctacagcatctacacgctgctg
ccggtgcggatgagggctgcggttatcagtggggtggtgctgtccgccatccacctggcc
gtctccctcaagatcaacgcagaggataagttcctcctcaaacagctggtctccaatgtt
ctcatcttctcctgtacaaacattgtaggcgtgtgtacccactacccagcagaggtgtcc
caaagacaggctttccaggagaccagggaatgcatacaagccaggctgcattctcaaagg
gaaaaccagcagcaggagcgtctcctgctctctgtacttcctcgacatgttgccatggag
atgaaagctgacattaatgccaagcaggaagatatgatgtttcataagatctacatccag
aagcatgacaacgtcagcatcctctttgcagacatagagggtttcacaagtctggcctcc
cagtgcactgctcaggagctggtcatgacgctgaacgagctctttgccagatttgataag
ctagcagctgagaaccactgtttacgtatcaagatcctgggtgactgctattactgtgtg
tctgggctgccagaagcaagagctgaccatgcacactgctgtgttgaaatgggaatggat
atgatagaggccatctcattagtccgggaggtgacaggagtaaatgtcaacatgagggtt
ggaatccacagcgggagagttcactgtggggtcttgggccttaggaagtggcagttcgat
gtgtggtcgaatgatgttacattagcaaaccacatggaagcagggggcaaagctgggcgc
atccacataacgaaagcaaccctgaactatctcaatggagactacgaggtggagctgggc
tttggaggggaacgcaatgcttatctgaaagagcacagtatcgagaccttcttgattgta
cgatgcagccagaaacggaaagatgagaaagccacgatagccaagatgaaccggcagcgc
accaactccatcagccacaacccgccacactggggtgtcgaccggcccttttacaaccac
ctcggagctcaccaggtctccaaggagatgaagagaatgggttttgaggaccccaaagac
aagaatacccaggaaagtatgaacccagaagatgaagtggatgagtttctgggcagggcc
attgatgccagaagtattgatcgattacgctctgagcacgtgcgcaagtttctcctaaca
ttcagggagcctgacctggagaaaaagtactccaagcaggtggatgacaggtttggagcc
tacgtggcttgtgcctccctagtcttcctcttcatctgctttgttcagatcataatcgtg
ccacactctacgtttatgctgggtttttacctgacctgttttctgatcttgaccacggtg
gtgtttgtttccatcatttactcctgtgtaaagcttttcccagcaccactccagactctt
tctaagaagattgtacagtccaggaccaatagtaccttagtcggagtctttgccattatc
ctggtttttctctctgcctttgtcaacatgttcatgtgcagcactgtggatcttgccagc
tgcatggctgcagaatacaacatcactcctgaccgggtggacatatgccttatcagcaac
ctgacttccaactacagcctgggcacgttgcagggattctgtgacagtcctttgcccaac
tgcaactttccagagtactttacctacagtgtcttattgagtctcctggcctgctctgtg
ttccttcagatcagctgtattggaaaactgatccttatgttaatcattgaatttatatat
gttctcattgtggaagtgccaggggtgaacctttttgacaatgcagatctcctggttaca
gctaacacctacatgtcaacaaattcaacgttaccatgctctccagctatgacacgagtt
gcactgaagatcgtcacccctgtcatcattaccgtctttgtcctggcactgtacttgcat
gcccagcaagtggaatccactgcaaggcttgacttcctctggaaactccaggccactgaa
gagaaagaagaaatggaggagctgcaggcctataacagacgcctcctccacaacattttg
ccgaaggatgtggcagcccatttcttggctcaggagcggcgcaatgatgaactgtactac
cagtcctgtgagtgcgtggctgtcatgttcgcctccataagcaacttctctgagttttac
gtggaactggaggccaacaacgagggggtggagtgtctgaggctgctcaatgagatcatt
gccgattttgatgaaataataagtgaagaccaatttcggcagctggagaagatcaaaacc
attggcagcacatatatggctgcgtcaggcctcaacgactccacttatgacaaggaaggg
aagacgcatatcaaagctctggccgattttgccatgaggttaatggaccaaatgaaatac
attaatgaacattcattcaacaacttccagatgaagataggcctcaacattggtcctgtg
gtagctggggtgataggggcgcgtaagccccagtatgacatatggggaaacacagtgaat
gtagccagccgaatggacagcacaggggtgcccgacaggattcaggtaaccacagacatg
taccaggttttagcagccaacaactatcagctggaataccgaggcgtcattaaggtgaaa
ggcaaaggagaaatgaccacctacttcctaaatgaagggcctccaattagttag

KEGG   Gallus gallus (chicken): 415732
Entry
415732            CDS       T01006                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    415732 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    415732 (ADCY7)
   04020 Calcium signaling pathway
    415732 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    415732 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    415732 (ADCY7)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    415732 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    415732 (ADCY7)
   04916 Melanogenesis
    415732 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    415732 (ADCY7)
   04270 Vascular smooth muscle contraction
    415732 (ADCY7)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     415732 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 415732
NCBI-ProteinID: XP_015147887
CGNC: 2808
Ensembl: ENSGALG00000003837
UniProt: E1C8F6
Position
11
AA seq 1079 aa
MPARGKYFFSESDDCRITDPLYEKYRYTSQQLPLLLLLLFIAIIFWTTLIIIFFVKDEAR
IHLAFIIAVCAVLVIFSVMYLLLCIESLFRRWLTLFGVTIWICFLTIGYIPLLEREDYFS
AWEQVPFFLFIIFTVYTMLPFGMRDAVIISVLSALSHIIVLSVLSRDSHADKRSILFQVL
ANAVIFLCGNLMGAFHKRQMQVASWDLYRYTLKCIQVRMKLKIEKRQQENLLLSILPAHI
SMEMKLAIIERLKDTNDNRQMHDNNFHILYVKRHENVSILYADIVGFTRLASDCSPKELV
VMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPVSLPVHARNCVKMGLDMCEAIKQV
REATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMESAGVPGRVHITEATL
NHLGKAYEVEEGNGHLRDPYLESMNIKTYLVVDPRSKQCKSNNHLPKTRVNDGLKMRASV
RMTRYLESWGAARPFAHLNHRESVSSDSSTSQGRQRKEIPLCSTGRQRTSDRNSSQKGRI
EEDIYDEMMSTIEGLSSTNPWCGKSDDFCGFSLIFAEPGLEKEYRTITILKLKSYFACAS
FVFLCIFLIQVFIMPKTTKLGISFGVVAIIIALVLFVCFAEKCMKCCSERWPFLHRLCTI
SEKVETMPLLRLPLAVITIGALLIIAIFNLTTEKNNAANVTGSDDLNGTANVSYVFISKS
FENTTEYFVEETYYAYCCILGFIACSVFLQMSFELKVLLLSIAVTVYLIIFNTLPHRNTT
VSVNVTRLFIEEPRIMINIYLVLFYITLILLAKQIDYYCRLDCLWKNKFKKEHEQFETME
NVNRLLLENVLPAHVAAYFIGEKRNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGL
ECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVTPGQENNQDKERQHAHI
GIMVEYGIALMSKLDGINRHSFNNFRLRIGINHGPVIAGVIGARKPQYDIWGNTVNVASR
MESTGELGKIQVTEETSRILQDLGYSCECRGLINVKGKGELRTYFVCTETAKFQGIGLN
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgccagctaggggtaaatatttcttcagtgaaagcgatgactgtaggatcacagaccct
ctctatgagaagtaccgttatacgagccagcagcttccactcctgctactgctgctcttc
attgcaatcatcttctggactacactaattataatcttttttgtcaaagatgaagcacgt
attcatcttgccttcattattgcagtgtgtgctgttcttgtcatattttcagtcatgtac
ttacttttatgtatcgaatccttatttcggagatggctaacgttatttggagttacaatt
tggatttgcttcttaacgataggttacattcctcttcttgaacgagaagattatttttca
gcatgggaacaggtgccattttttctgttcataatcttcacagtttataccatgctaccc
tttgggatgagagatgcagtcataattagtgttctttctgctctctcccatattattgtg
ctaagtgtgttatccagggattctcatgcagataaaagatccattctgtttcaggtactt
gccaatgctgtcattttcctttgtggtaatttgatgggtgcatttcacaaacgccaaatg
caggttgcttcgtgggatttgtatagatacacattaaagtgcattcaggtccgaatgaaa
ctgaagattgaaaagaggcaacaagaaaatttacttttatccatactgccagctcatata
tctatggaaatgaagctggcaatcatagagcgactaaaggatactaatgataataggcaa
atgcatgacaacaacttccacattctgtatgttaaaaggcacgaaaatgttagcattctc
tatgcagacattgtaggatttactcgccttgccagtgactgctctcctaaggaactggta
gtgatgctgaatgaactttttggaaagtttgatcagattgcaaaggagaatgaatgcatg
agaataaaaatcctgggagattgttactactgtgtgtcaggcctacctgtgtccttgcca
gtccatgccaggaactgtgttaaaatgggactggacatgtgtgaagcaataaagcaggtg
agagaagccacaggtgtggatatcaacatgagagttggcattcattctgggaacgtactg
tgtggtgtgattggcctccgcaagtggcagtacgatgtctggtctcacgatgtttcctta
gcgaaccgcatggagtctgcaggcgtacctggtcgtgtacacatcactgaagcaacgcta
aatcacttgggcaaggcttatgaagtagaagaaggaaatggacaccttagagatccttac
cttgaatccatgaatatcaaaacctacttggtggttgatccaaggtccaaacagtgcaaa
tcaaataatcatcttcctaaaacaagagtgaatgatgggctgaagatgcgggcatctgtt
cggatgacacgttatttagaatcctggggagcagctaggccttttgcccacctaaaccat
agagaaagtgtgagcagtgactcttcgacttcacaaggaaggcaacgaaaggaaatacct
ctgtgttccactgggcgccagaggacttctgacagaaattcatctcagaaggggagaata
gaggaagatatttatgatgaaatgatgtcaaccattgaaggactcagttcaactaaccca
tggtgtggcaaatctgatgacttctgtggattttcactgatatttgcagaacctggtctt
gaaaaagagtatcgcaccattactattctaaaactgaagagttactttgcgtgtgcaagt
tttgtgttcctctgtatttttctgatacaagtgttcataatgcccaaaactacaaaacta
ggaatttcctttggcgtcgttgcaatcatcattgcactcgttttgtttgtgtgctttgct
gagaaatgtatgaagtgctgctcagaaaggtggcctttcctacaccgtctttgcactatc
tcagaaaaagtggaaacaatgcctttgcttaggcttcctttagcagtcatcactataggt
gccttgttgattatagccatttttaacctgactactgaaaagaacaatgctgcaaacgtt
actggctcagatgacttgaatggcactgccaatgtgagttatgtcttcatttctaagtca
tttgaaaacacaactgagtacttcgttgaggaaacttattatgcttattgctgcattttg
ggattcattgcttgctcagtatttcttcaaatgagcttcgaactcaaagttctcctcctg
tccattgcagtaactgtatacctcatcatttttaatacccttccacatagaaatacgact
gtctctgtcaacgttaccaggcttttcattgaagagccaagaataatgattaatatatat
ctggttctgttttacataaccctaatattacttgcaaagcagattgactattactgtcga
ctggattgtctgtggaagaataagtttaaaaaagaacatgagcagtttgaaacaatggag
aacgtcaacaggcttttactggaaaatgtacttccagcacacgtcgctgcctatttcatt
ggtgaaaagcgaaatgaggactggtaccatcaatcttatgactgtgtctgtgtcatgttt
gcatcagtgccagattttaaggtgttctatactgaatgcgatgtcaataaagaaggtctg
gaatgcttgcgactgttgaatgaaatcattgctgattttgatgagctcttgttaaaacct
aaattcagtggtgttgaaaaaataaagacaattggaagcacttacatggcagcagctggc
ctcagtgtcacgccaggccaagagaacaaccaggataaggagagacaacatgcacacatt
gggattatggtggaatacgggattgccttgatgagtaaactggatggcatcaaccgacac
tcctttaacaatttccgattacgtattgggataaatcatggtcctgtgattgctggtgta
atcggtgcccggaagcctcaatatgatatctggggtaacaccgttaacgttgccagcagg
atggagagtacaggggagcttggaaaaatccaggtcacagaagaaacgagtagaatacta
caggacctgggatattcgtgtgaatgtaggggactcattaatgtcaaaggaaagggggaa
ctgaggacttactttgtttgcaccgagacagccaaattccaaggtattggactgaactga

KEGG   Gallus gallus (chicken): 420328
Entry
420328            CDS       T01006                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X2
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    420328 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    420328 (ADCY8)
   04020 Calcium signaling pathway
    420328 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    420328 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    420328 (ADCY8)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    420328 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    420328 (ADCY8)
   04916 Melanogenesis
    420328 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    420328 (ADCY8)
   04270 Vascular smooth muscle contraction
    420328 (ADCY8)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     420328 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N LCE TBK1_ULD DUF1053
Other DBs
NCBI-GeneID: 420328
NCBI-ProteinID: XP_004940099
CGNC: 12189
Ensembl: ENSGALG00000030251
UniProt: A0A1D5PGV0
Position
2
AA seq 1174 aa
MELSEVRCLSDSDELYTINRTPPGSSRPQRLLWQTAVRHITEQRFIQEHSSSSGGSSSVG
GKGFSSEETCCPNHHPHHHHHHFRRQSAGRSLGSERHNNGGTKVFPERTSSNGDLGFLPL
DCAPSNSDFFLNWGYTYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVMNILDVLT
KLTLLFLHLTLASAPMDPIKGILLGFFTGIEVVICALVVVRKDTTSYTYLQYSGVVTWVA
MATQILAAGLGCGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLVTSVLQLIMQLVIPR
LAVTSLNQIAAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQER
LVLSVLPRFVVLEMINDMTNVEDEHLQHQFHKIYIHRYENVSILFADVKGFTNLSTTLSA
QELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKT
IRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHIS
KATLDCLNGDYKVEEGHGKERNEFLRKHNIETYLIKQPEESLLTLPEDIVKEAVSSSDSR
NSGATFTEGSWSPELPFDNIVGKQNYSQMRDEVFKSNLVCAFIVLVFITAIQSLLPSSRV
IPMVIQFSILIMLHSALVLITTAEDYKCLPLMLRKTCCWINETYLARNVIIFASILINFL
GAIINILWCDFDKPVPLKNQTFNSSASFSDICSYPEYFVFTGVLAMVTCAVFLRLNSVLK
LAVLLIMIAIYALLTETIYASLFLQYDHLNHNGETDFLGTKEASLLLMAMFLLAVFYHGQ
QLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQS
YDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEERFQDIEKIKTIG
STYMAVSGLSPEKQQCEDKWGHLCALADFSIALNESIQEINKHSFNNFELRIGISHGSVV
AGVIGAKKPQYDIWGKTVNLASRMDSTGVSDRIQVPEETYLILKDRGFAFDYRGEIYVKG
ISEQEGKIKTYFLLGRVQPNPLILQPRKLTGQYSLAAVVLGLVQSLNRQKQKQILNENNN
SGIIKGHYNRRTLLTPGGSEAAAQAEGADKTELP
NT seq 3525 nt   +upstreamnt  +downstreamnt
atggagctctcggaggtgcggtgcctgagcgacagcgatgaactttacaccatcaatagg
accccccccggcagcagcagaccccagcgcctgctgtggcagacggccgtgcgccacatc
accgagcagcgcttcatccaggagcacagcagcagcagcggcggcagcagcagcgttggg
ggcaagggcttcagctcggaggagacctgctgccccaaccaccacccgcaccaccaccac
caccacttccggagacagtcggccggacggagtttgggcagcgagcgtcacaacaacgga
ggcaccaaagtcttcccggagcgcacgagcagcaatggggacctgggctttttgcccctg
gactgtgcccccagtaactccgacttcttcctcaactggggctacacctaccgcggggtg
atcttccccactctccgcaattccttcaagtcccgggacctggagcgcctttaccaacgc
tacttcttgggccagcggcgcaaatccgaggtggtcatgaacatcctggacgtgctgacc
aagctgaccctgctgttcctccacctgaccctggcctccgctcccatggaccccattaag
ggcattctcttgggcttcttcactggcattgaggtggtgatctgtgccttagtggtggtc
aggaaggacacaacctcatacacctacctgcagtacagcggtgtggtcacttgggtggcc
atggccacgcagatcctggcagctggcctgggctgtggcctccttggggatggcattggc
tatgtgctcttcacacttttcgcaacctacagcatgctcccgctgccgctcacctgggcc
atcctggctgggctggtcacctctgtcctgcagctcatcatgcagctggttatccctaga
ttggccgtgacttccctcaaccagatagcggcccaggcagtattatttatgtgtatgaac
accgcaggaatcttcattagctacctatcagacagagcacaacgtcaagccttcctggag
accagaagatgtgtagaagccagactgaggctagagacagaaaaccagcgacaggaacgg
ctggtgctctctgtcttgccacggtttgtagttctggaaatgataaacgatatgaccaat
gtagaagatgaacatttacaacaccagtttcataagatctacattcatcgctatgagaat
gtcagcattctttttgcagacgttaaaggattcacaaacctctccacgactctatcagcc
caggaactggtccgaatgctgaatgaactctttgcaagatttgaccgactagcacatgaa
catcattgtcttagaataaagatcctgggagactgttactactgcgtgtctgggcttcca
gaacctcgccaggaccatgcacactgctgtgttgaaatgggactcagtatgattaaaact
atcagatatgttaggtcaagaacaaagcatgacattgacatgagaatagggatacattca
ggatcagttctgtgtggagtgctgggcctgcgaaagtggcagtttgatgtctggtcatgg
gatgtggatattgcaaacaaactcgagtctggtggaattcctgggagaatccacatctcc
aaagccactctggactgcctcaatggggattataaagttgaagaagggcatggcaaagaa
cgcaatgaattcttgaggaaacataacattgagacttatttaattaaacaacctgaggag
agtctgttgactttgcctgaagatattgtgaaagaggctgtcagctcctccgacagcaga
aacagtggggcaacatttaccgaaggatcatggagccctgaacttccattcgataacata
gtgggaaaacagaactattctcaaatgcgagacgaagtatttaaatcaaacttggtatgc
gcatttattgttctcgtattcatcactgctatccaaagcttacttccttcttccagggtg
ataccaatggtcattcaattttctattctgattatgttgcactccgctcttgtgctaatc
accacagcagaggattacaaatgtttacccttaatgctccggaaaacttgctgctggatt
aatgagacctacttggccaggaatgttattatatttgcatctattctgattaattttctt
ggagccatcataaatattctatggtgtgattttgacaaaccagtacctctgaagaaccag
acgttcaattcatctgcatccttttctgacatctgttcctatcctgagtattttgtcttc
actggtgtgctggcaatggtgacttgtgcagtctttcttcgtctcaactctgtcctgaag
ttggcagtacttctcatcatgattgcaatctatgctctactgactgagaccatttatgct
tcacttttcctgcaatacgaccacttaaaccacaatggagaaacagacttcctgggtaca
aaggaggcatctttactactgatggcaatgttccttttagctgtattttatcacggtcaa
cagcttgaatacacagcaaggctggattttctgtggcgtgttcaagcaaaagaagaaatc
aatgaaatgaaggagttaagggagcacaatgaaaatatgctgcggaatattttacccagt
catgttgcacgtcacttcttggagaaggatcgggataatgaagaattgtattcacagtct
tatgatgcggttggagtgatgtttgcttctattcctggatttgctgacttctattcccag
acagagatgaataaccaaggagtagaatgtctacgcttgctgaatgaaatcattgcagac
tttgatgagctactaggtgaagagagattccaggatattgaaaaaattaaaacaatcggt
agcacatacatggctgtgtcaggattatcacctgaaaaacagcaatgtgaagacaaatgg
gggcatttgtgtgctctagctgacttctccatagcattgaatgaaagtatacaggagatc
aacaagcattcatttaacaactttgaactccgtattgggattagtcatggctctgttgta
gcaggagttatcggtgccaagaaaccacagtatgatatctggggcaaaacagttaattta
gcaagtcgaatggacagcacaggagttagtgacagaatacaagtgcctgaagaaacatat
ctgatcctgaaggaccgaggatttgccttcgactaccgaggagagatttatgtcaaaggc
atcagtgaacaggaaggaaaaatcaaaacgtattttcttctaggaagagttcaaccaaat
cctttaatcttacaaccaagaaaactgactgggcagtattcattagcagctgttgtacta
ggacttgtacagtctcttaacaggcaaaaacagaaacaaatccttaatgagaacaataac
tctggaatcataaagggacattataaccgcaggactttgctcactcccggtggatctgag
gcagcagcccaggctgagggggctgacaaaactgaattgccataa

KEGG   Gallus gallus (chicken): 420788
Entry
420788            CDS       T01006                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1 isoform X2
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    420788 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    420788 (ADCY1)
   04020 Calcium signaling pathway
    420788 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    420788 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    420788 (ADCY1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    420788 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    420788 (ADCY1)
   04916 Melanogenesis
    420788 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    420788 (ADCY1)
   04270 Vascular smooth muscle contraction
    420788 (ADCY1)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     420788 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 420788
NCBI-ProteinID: XP_025003369
CGNC: 9443
Ensembl: ENSGALG00000031170
Position
2
AA seq 1042 aa
MNGNDMEEIPFHKVKTKRKKCFHCCCSPPAAAVAGAGARLGEPPPLLLLDAIACEDEFDC
KELEALFQSYNLKLEQKSTLKALAVLIVLTASLALVELLSGPSLTISKGSHPVHCIIFLS
LFIVTNVKYLQVTQLQQIVKLTLLFSFTFSFLCCPFSLGAYGMEPPSAPEQGMWQLMLVT
FVSYSLLPVRTLLAIVFGLVVSISHLIVTATSVSAKRQRLWRTLVANAILFVSVNLYGVF
VRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI
FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKIL
GDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLG
LRKWQYDVWSNDVTLANVMEAGGLPGKVHITKTTLECLNGDYEVEPGYGHERNSFLKKHN
IETYFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTC
EDDDKRRALRTASEKLRNRSSFSTNVVYNTPGTRVNRYISRLIEARQTESEMADLNFFTL
KYKQIEREKKYHQLQDEYFTSAVVLSLILAALFGLVYLLIIPQSTIVLVLLVFCICFLVA
CIMYLHVTRVQCFPGCLTIQIRTILCIFIVILIYSVAQGCVVGCMPWVWNTNSSSSIVII
SPGGTNKTMNELPCDTAHYAFLSCVVGTLTLAIFLRVSSLPKIILLLFVTILYIVVLELS
GYRKAVGGGSFYMRGYEPTLAILLFSCALALHSRQVDLKLRLDYLWAVQAEEERDDMERV
KLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNM
GVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMAAVGLVPTSGTKAKKSIYSHLS
TLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRM
DSTGVQGKIQGKFKKIFLQEGC
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgaatggcaatgatatggaggaaataccgttccataaagtcaagaccaagaggaagaag
tgcttccactgctgctgctctccgcccgctgccgcggtggcgggagcgggagccaggctg
ggggaacctcctcctctgctgctgctggatgccattgcctgtgaagatgagttcgactgc
aaagagctggaagctcttttccagagctacaacctgaagctggagcagaagtctaccctc
aaagcgctggccgttcttatcgtgctgaccgccagcctggcccttgtggagctgctctct
ggacccagcttgaccatttccaaaggctcgcacccggtgcactgcatcatcttcctttct
ctctttatcgtcactaacgtcaaatacctgcaggtcacccagctgcagcagatagtcaag
ctcaccttgctctttagcttcaccttctccttcctctgctgccccttttcgctaggcgcc
tacggcatggaaccccccagcgccccggagcagggcatgtggcagctcatgctggtcacc
ttcgtctcgtattcactgctgcccgtccggaccctgctggccatcgttttcggactcgtg
gtgtccatctcccatctcatcgttactgccacctccgtcagcgccaagcggcagcggctc
tggaggacgcttgtggccaatgcaatcctttttgtcagtgtaaatttgtatggggtcttt
gtgaggattttgacagagagggctcagaggaaggcattccttcaggccaggaactgcata
gaggacaggctgaggctggaggatgaaaatgaaaaacaggagcgtctcttgatgagtctt
ttgcctaggaatgttgcaatggaaatgaaggaagattttttgaagcctcctgaaagaatt
ttccacaagatttacattcaaaggcatgacaatgttagcattttgtttgcagatattgtg
ggatttactagtttggcatcacagtgcactgcccaagagctggtgaagctgctaaatgag
ctctttggtaaatttgatgagttagctactgaaaatcactgcagaagaataaaaatccta
ggtgactgttactattgtgtatcaggcttaacccaacccaaaacggaccatgcccattgc
tgtgttgaaatgggactggatatgattgacaccatcacatctgttgcagaagccacagag
gttgatctcaacatgagagttggattacatacaggaagggtgctttgtggtgtcctaggt
ctccgaaaatggcaatacgatgtctggtcaaatgatgttactttagccaatgtaatggaa
gctggaggattgcctgggaaagttcatattacaaagaccaccctagagtgcctaaatggg
gactatgaagtagaaccaggatatggccatgaaaggaatagtttcttgaagaaacataat
attgaaacatactttattgtgccatcccacaggagaaagatatttcctggactgattcta
tcagacattaagcccgccaaaagaatgaagttcaagacagtctgttatctgcttgttcag
ctcatgcactgtcgtaagatgttcaaagcagagatccctttctccaatgtcatgacatgt
gaagatgatgataagaggagagcgttaaggacagcctctgaaaagctcaggaatcgttcc
tctttttctaccaatgtcgtgtacaacactccaggaactcgagtaaacagatacatcagt
cgtttgatagaggcccggcaaactgagtctgagatggctgatttgaacttctttaccctg
aagtacaaacaaattgagcgtgaaaagaaataccaccagcttcaggatgaatacttcacc
agtgctgtagttctctcactaattctagctgccttatttggccttgtctaccttctaata
ataccacagagtaccatagttcttgttctcctggtgttctgcatatgcttcctagtggct
tgcattatgtacctacatgtcacaagagtacaatgttttccagggtgcctaacaatacag
attcgtaccattttgtgtatatttattgtgatcttaatatactctgtggctcaaggatgt
gtggttggctgcatgccttgggtttggaataccaattccagcagttcgatagttatcatt
tctcctggtggaacaaataaaacaatgaatgaacttccatgtgatacagcccactatgct
ttcctttcctgtgtagtggggactctcaccttggcaatatttctacgcgtatcttccttg
ccaaaaattatactgctgctttttgttactattttgtacatagttgttctggaactcagt
ggttacagaaaagcagtggggggtggatccttttatatgcgaggctatgaaccaacacta
gctattttgctattttcttgtgctttggcactgcattcgagacaggtggacttgaagcta
cgtctggactacctctgggctgtgcaggcagaagaagagagagatgatatggagagagtc
aagctggataataaaagaattctcttcaacctattgccagcacatgttgcacagcatttt
cttatgtctaatccaaggaatatggacctttattaccagtcatattcacaagtgggagtg
atgtttgcttccatcccaaatttcaatgatttctacatcgaactggatggcaataatatg
ggagtggagtgtttacgcctgttaaatgaaattattgctgattttgatgagcttatggac
aaagaatgttataaagacatagaaaaaatcaagacaattggaagtacatatatggcagct
gtgggacttgtacctacttcaggaactaaggctaaaaaatcaatttattcccatttgagt
acactcgcagattttgcaatagagatgtttgatgttcttgatgaaatcaactatcagtct
tacaacgattttgtcctgagagttggtattaatgttgggcctgtagtagctggagtcatc
ggagccagaagaccacagtatgatatctggggaaacactgtaaatgttgccagccggatg
gatagtactggggtgcaggggaaaattcagggtaagtttaagaaaatctttcttcaggaa
ggctgctag

KEGG   Gallus gallus (chicken): 420935
Entry
420935            CDS       T01006                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2 isoform X1
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    420935 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    420935 (ADCY2)
   04020 Calcium signaling pathway
    420935 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    420935 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    420935 (ADCY2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    420935 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    420935 (ADCY2)
   04916 Melanogenesis
    420935 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    420935 (ADCY2)
   04270 Vascular smooth muscle contraction
    420935 (ADCY2)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     420935 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 420935
NCBI-ProteinID: XP_015137790
CGNC: 9875
Ensembl: ENSGALG00000013060
UniProt: E1BX91
Position
2
AA seq 1101 aa
MWREAMMGRRRRRYLLERAEQAGGCGAGGEQSRSRDWLYESYYCMSQQHPLIVFLLLIVM
GACLALLAVFFASGLEMEDHVAFLITVPTALAIFFAIFILVCLEPVFKKLLRIFSLVVWV
CLVAMGYLFMCFGGIICPWDQVSFFLFIIFVVYTMLPFNMRDAIVASVLTSASHTIVLSV
CLSGTAVIKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEF
EKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQLENTNNFHNLYVKRHTNVSILYAD
IVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLQNHA
KNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANH
MEAGGVPGRVHITSVTLAHLNGAYKVEDGDGDVRDPYLKEHNVKTYFVINPKGEKRSPQH
HIRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQYHF
QRCRERTKSQKRRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKTLEKEYRAT
TLPAFKYYVTCACLIFFCIFVVQILVLPKTSILGISFGVAFLLLSFILFICFAGQLLQCS
KKASASLLWILKSSGIIANRPWPRITLTLTTTAIILTMAVFNMFFPDNAVTAFPSDLNSS
NASFPNLSNQTRWCIQNNCFFLPYFIYSCILGLISCSVFLRINYELKMVIMLIALVGYNV
ILLHTHGSMLDDYSKFMYATAPLKRPGVLKDLKTMGSVSLFIFFVTLLVLGRQNEYYCRL
DFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARNLKNEDLYHQSYDCVCVMF
ASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATG
LSATPNQEQYQEPERQYMHIGTMVEFAFALVAKLDVINKHSFNDFKLRVGINHGPVIAGV
IGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETNNVLQTLGYMSTCRGIINVKGKGE
LKTYFVHTEMTRSLSQGNVAS
NT seq 3306 nt   +upstreamnt  +downstreamnt
atgtggcgagaagcgatgatgggcaggaggagacgccgttacctgctggagcgggcagag
caggcgggcggctgcggggcgggcggcgagcagtcccgctcccgggactggctctacgag
tcctactattgcatgagccagcagcacccgctcatcgtcttcctactcctcatcgtgatg
ggcgcctgcctggccctgctcgccgtcttcttcgcctccggactggaaatggaagaccat
gtggcatttttaataactgttccaacagccctagcaattttttttgctatatttatcctt
gtctgcttagagcctgtctttaagaagctgctccgtatattttcactggtggtctgggta
tgtcttgttgccatgggatatctctttatgtgtttcggaggaatcatctgtccctgggac
caggtatcatttttcttgttcattatttttgtggtgtataccatgctgcccttcaacatg
agggacgctatagttgccagcgtcttgacctctgcatctcatacgattgtgctgagcgtc
tgtctatcaggtacagctgttataaaggagcacttggtttggcagatattggcgaatgta
atcattttcatctgtggaaacttggctggagcataccacaaacacctcatggagctggca
ctgcagcagacataccaggacacgtgcaactgcatcaaatcgcggatcaagttagaattt
gagaagcggcaacaggagcgtctccttctttctttactgcctgctcacattgccatggaa
atgaaagcagagatcattcagaggttacaaggtcccaaggctggtcagctggaaaatacg
aacaacttccacaacttgtatgtcaaacggcacaccaatgtaagcatcttgtatgctgat
attgtgggattcactcgcctggccagtgactgctcaccaggggaactggtgcacatgctg
aatgagctgtttggcaagtttgatcaaattgcaaaggaaaatgaatgtatgagaattaaa
atcctaggtgactgctattactgtgtttctggactacctatatctcttcaaaatcacgcc
aagaattgtgtgaaaatgggactggacatgtgtgaagccattaagaaagtgagagatgca
actggagttgatattaatatgcgtgtaggagtgcactctggaaatgtactttgtggagtt
attgggctacagaagtggcagtacgatgtgtggtcgcatgatgtcactctggcaaatcac
atggaagctggaggggtccccggccgtgttcacatcacttcagtcaccttggcacatttg
aatggagcttacaaagtggaagatggggatggagatgtgagggacccatatctgaaagag
cataatgttaagacttactttgtaatcaatcctaagggagagaagcgaagtcctcagcac
cacattagacctcgacatactcttgatggagccaaaatgagagcttctgtccgcatgacc
cggtacctggaatcttggggagcagccaagccatttgcacacttgcaccacagggacagc
atgaccactgaaaacggcaagattagcacaacagatgttcccatggggcagtatcatttt
cagcgttgcagagagagaacaaaatctcagaaaagaagatttgaagaggaactgaatgag
aggatgattcaggccattgatggaattaacgctcaaaagcagtggcttaaatctgaagac
attcaaagaatatcacttcttttctataataagactctggaaaaagaatacagagcaacc
actctgcctgcatttaagtactacgtgacttgcgcctgtctcatattcttctgcattttt
gttgtgcagattctggtattgccaaaaacatctattcttggaatttcatttggggtcgcg
tttctcttgctctctttcattttatttatctgctttgctggacagcttttgcaatgtagc
aagaaagcatcagcttcactgttgtggatcctgaaatcatctggaattattgcaaaccgt
ccttggccacggatcactctcacactgacaaccactgctataatattaactatggctgtg
ttcaacatgtttttcccggataatgctgtgacagcttttccctcagatcttaattcgtca
aatgcaagttttcctaatttgagtaatcagacacggtggtgtatacaaaacaactgtttt
ttcctaccgtattttatatacagctgcatattagggctcatttcctgttccgtttttctg
aggataaattatgagctgaaaatggtgatcatgttgattgcattagtgggctacaacgtt
atccttctgcacactcacgggtccatgctggatgactacagcaaatttatgtacgcaaca
gcacccctgaaaaggcctggagtactgaaagacctgaagaccatgggctcagtgtctttg
tttatattcttcgtcacattactggttttgggtagacagaatgaatattactgtaggtta
gacttcctgtggaagaacaagttcaaaaaagagcgggaggagattgaaaccatggagaac
ctaaatcgggtgcttctggagaatgtgcttccagcccacgtagctgaacacttcttggca
agaaacctgaagaacgaggatctatatcatcagtcatatgactgtgtctgtgtcatgttt
gcctctattccggatttcaaggaattttatacagaatctgatgtaaataaggaaggcttg
gaatgtctcaggctgctaaatgagatcattgctgacttcgatgatttattgtctaagcca
aagttcagtggagttgaaaagataaaaaccattggaagcacgtacatggcagcaacagga
ttgagtgctacacccaaccaagaacagtatcaggaacctgaacgacagtatatgcacata
ggaaccatggtggagtttgcatttgccttagtggcgaaactggatgtcataaacaaacat
tctttcaatgacttcaagttacgagtaggtattaaccatggacctgtaatagctggagta
attggagctcaaaaaccacaatatgatatctggggcaatacagtaaatgtggccagcagg
atggacagcactggtgtcttagataaaatacaggttacagaagagacaaacaatgtcctg
caaacactggggtacatgagcacttgcagaggaatcataaatgtaaaaggaaaaggagaa
ctgaagacgtactttgtacatacagaaatgacaagatccctttcacaagggaatgtggca
tcttga

KEGG   Gallus gallus (chicken): 422013
Entry
422013            CDS       T01006                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    422013 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    422013 (ADCY3)
   04020 Calcium signaling pathway
    422013 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    422013 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    422013 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    422013 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    422013 (ADCY3)
   04916 Melanogenesis
    422013 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    422013 (ADCY3)
   04270 Vascular smooth muscle contraction
    422013 (ADCY3)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     422013 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1673 fn3_4
Other DBs
NCBI-GeneID: 422013
NCBI-ProteinID: XP_015140678
CGNC: 12445
Ensembl: ENSGALG00000016608
Position
3
AA seq 1128 aa
MPRNRDFSEPEYSAEYSADYSVSLPSDPEHAVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLLTCAAVYAADKLAPALAAGTGLAAHVL
LFALCKYRLLPERAARRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAVSCGVHTLVLGVTVAQQRQDALDEGTLLRQILSNIAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTAVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIVTYLIVVPKQPLRNGINGVKLSLTSSHGGSPLLVNTKERNGSVSLACTSPEEP
DEPNARVRGTKENGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALL
ERESVQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDP
WLVANYVTFVVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIII
VTMADIVDMLSCQQDYSGTGNGTVVPPRPGGCWEQPKYYSYIAVLALVATIMLVQVSHMV
KLTLMVLITGAAGTVNIYAWEHIFDQYDRRRSQQSIRSSLVPSKYSMTAMIFIVMLSFYY
FSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELY
SQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIK
TIGSTYMAASGVTPDANANGYSTKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFN
NFMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEY
GFRFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgccgaggaacagggatttctcggagcccgagtactcggccgagtactccgccgactac
tcggtgagcctgccgtcggaccccgagcacgccgtgggccggacccacgaggtgacggtg
cgcagctcggggccgtgcctctgcctgccccgcttcatgcgcctcaccttcgctcccgag
tccctggagaacctctaccagacctacttccgtcgccagcgccacgagaccctcctggtg
ctggtggtcttcgccgccctcttcgattgctacgtcctcctcacgtgcgccgcggtctac
gccgccgacaagttggccccggcgttggcagcggggactgggttggccgcccacgtgttg
ctcttcgccctctgcaaataccggctgctccccgagcgcgccgcccgccgcttcctgccc
tacgtcctctgggtcctcatcttggcccagatcttctgctacttgggcctcaacttctcg
cgctcgcccgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgttgccgctgcgcctggcgcccatcgtgctcatcaccgccgtgtcctgcggcgtc
cacacgctggtgctcggcgtcactgtcgcccagcagaggcaggatgccctggatgagggc
acgctgctgagacagatcctgtccaacattgccatctacctttgtgccatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaagcgcggcag
tccctcgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcatgtggcggatgagatgctgaaggatatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctctttgcagacatcgtgggcttcacgcagctctcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaacgagctcttcgcccgcttcgacaagctggcagctaaataccaccag
ctgcgcatcaagatcctgggtgactgctattactgcatctgtgggctgcccgactaccgg
gaggaccacgccgtctgctccatcatgatggggcttgccatggtggaggctatttcttac
gtgagggaaaagaccaagacagcggtggatatgcgtgtaggagtgcacagtgggacggtg
ctgggcggcgtgctgggccagaagcgttggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggcaggtggcatccctgggcgcgtgcacatctcgcagagcacc
atggattgcttgaagggcgaatttgaggtggagccaggcgagggtggctctcgctgcgag
tacctgaaggagaaaggcattgtcacctacctcatcgtggtgcccaagcagcctctacgc
aatggcatcaatggggtgaagctgtcactgacctcatcccatggaggctccccactgctc
gtcaacaccaaggagcgcaatggcagcgtcagcttggcgtgcaccagccctgaggagcct
gatgagcccaatgccagagtgaggggcaccaaggagaacggggaggaggatggagaggcg
gtgaacccatccttccccaacccgcggcgccggctgcggctacgggacctggctgagcgg
gtaatcgatgcatcacagaatgagcaggagctcaacaagctgctcaacgaggccctgctg
gagcgcgagtctgtccaggcgttgaaggggaagagcaccttccggctctccatgcgcttc
attgaccctgagatggagacacgctactcagtggagaaggagaagcagagcggtgctgcc
ttcagttgctcctgtgttgtcctcttcttcactgccttggtggaggtcttcattgaccct
tggttggtggccaactacgtgaccttcgtggtgggggagatcctgctgctcatcctcacc
ctctgctcactggctgccatctttccccgggtcttccccaaaaagctcgtggccttctcc
acttggattgacaggactcgctgggcacgcaacacctgggccatggctgccatcatcatt
gtcaccatggctgatattgtggacatgctcagctgccagcaggactacagtgggacaggc
aatgggacggtggtgccaccacggccaggcggctgttgggagcagcccaagtactacagc
tacatcgccgtgctggccctggtggccaccatcatgctggtgcaggtcagccacatggtc
aagctgactctcatggtgctgatcactggggcagctggcactgtcaacatctatgcctgg
gagcacatcttcgaccagtacgaccgccgccgcagccagcagagcatcaggtcctcactg
gtcccctccaagtactccatgacagccatgatcttcatcgtgatgctcagcttttactac
ttctctcgccacgtggaaaagctggccaggacgctcttcctctggaagattgatgtccat
gaccagaaggagcgggtctatgagatgcggcgctggaacgaagcccttgtcaccaacatg
ctgcccgagcatgtggccaggcacttcctgggctccaagaagagggatgaggagctgtac
agccagtcctatgatgagattggcgtcatgtttgcttctctccccaacttcgccgacttc
tacacagaggagagtatcaacaatgggggcatcgagtgcctgcggttcctcaacgagatc
atctctgactttgacgcactcctggatgaaccccagttccgctgtatcaccaaaatcaaa
accatcggcagcacctacatggccgcgtctggagtgacccccgatgccaatgccaatggc
tacagcaccaagaaggagaccctctcggataaggagcgctggcagcatttggctgacctc
gctgactttgccttggccatgaaggtgacgctgatgaacatcaactaccagtccttcaac
aacttcatgctgcgcataggcatgaacaagggtgccgtgctggcaggagtcattggtgcc
cgcaaaccacactatgacatctggggcaacacagtgaacgtggccagcaggatggagtcc
actggtgtgatggggaacatacaggtggtagaggagacacacctcatcctgaaggagtac
ggcttccgcttcgtgcgccgtggggccatctacgtcaagggcaaaggggagctgctcact
ttcttcctcaagggccgggagaagcagggctccttcgtcaatggctcatctgtcaccctg
ccccatcaggtggtggacagctcctga

DBGET integrated database retrieval system