KEGG   Gallus gallus (chicken): 107050378
Entry
107050378         CDS       T01006                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107050378
   04261 Adrenergic signaling in cardiomyocytes
    107050378
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    107050378
CD molecules [BR:gga04090]
 Proteins
  107050378
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107050378
NCBI-ProteinID: XP_025002271
CGNC: 73392
Position
Unknown
AA seq 196 aa
MARDKEKRSCGQMLAEWRAFVWDPRSRQVLGRTGTSWGLILLFYLLFYGFLAGLFSLTMW
VMLQSVDPHVPKYQDRLTTPGMMIRPRTEGLDVTFNVSHSHTWLHYVRALHAFLEPYNDS
LQAARNAPCAPGRYNEQPDDGVPNYPKRACRFNRSLLGPCAGLGEEHDYGYGVGRPCVLL
KVNRKSPFNRFFRIPI
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcgcgggataaggagaagaggagctgcgggcagatgttggccgagtggagggctttc
gtttgggacccccggagccgtcaggtgctgggcaggacgggcaccagctggggcctcatc
ctactcttctacctgctgttctatggcttcctggccgggctcttttccctcaccatgtgg
gtaatgctgcagagcgtcgacccccacgtgcccaaataccaggaccgcctcaccacccct
gggatgatgatccgcccgcgcacggaggggttggacgtcaccttcaacgtcagccacagc
cacacgtggctgcactacgtgcgtgcattgcacgccttcctcgagccgtacaacgacagc
ctccaggccgcccgcaacgccccctgcgccccgggtcgttataacgagcagccggacgac
ggcgtccctaattaccccaaacgagcttgtcgtttcaaccgctcccttttggggccgtgc
gccgggctgggagaggaacacgactacggttatggggtcgggaggccatgcgtgctgctc
aaggtcaataggaaatccccatttaaccgtttttttcgaatccccatttag

KEGG   Gallus gallus (chicken): 396529
Entry
396529            CDS       T01006                                 

Gene name
ATP1B1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396529 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    396529 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    396529 (ATP1B1)
CD molecules [BR:gga04090]
 Proteins
  396529 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 396529
NCBI-ProteinID: NP_990851
CGNC: 11333
Ensembl: ENSGALG00000015233
UniProt: P08251
Position
1
AA seq 305 aa
MARGKANDGDGNWKKFIWNSEKKELLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLL
TVSEFEPKYQDRVAPPGLTQVPQVQKTEISFTVNDPKSYDPYVKNLEGFLNKYSAGEQTD
NIVFQDCGDIPTDYKERGPYNDAQGQKKVCKFKREWLENCSGLQDNTFGYKDGKPCILVK
LNRIIGFKPKAPENESLPSDLAGKYNPYLIPVHCVAKRDEDADKIGMVEYYGMGGYPGFA
LQYYPYYGRLLQPQYLQPLVAVQFTNLTYDVEVRVECKEYGQNIQYSDKDRFQGRFDIKF
DIKSS
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcccgcgggaaggccaacgacggcgacggcaactggaagaagttcatctggaactcg
gagaagaaggagctgctgggccgtaccgggggcagctggtttaagatcctcctcttctat
gtcatcttctacggctgcctggcagggatcttcattgggaccatccaagtgatgttgctc
accgtcagtgaatttgaacccaagtaccaggatcgtgtggcacccccaggactgactcaa
gtcccccaggtacaaaagacagaaatttcctttactgtcaacgatcccaaaagctacgac
ccgtatgtgaagaatctggaggggttcttaaacaagtacagcgctggtgagcagactgac
aacatcgtatttcaggactgcggagacatacctacggattacaaagagagaggaccatac
aatgatgcccaaggtcagaagaaggtctgcaagttcaaacgtgagtggctggagaactgc
tctgggctgcaggataacacctttgggtacaaggatggcaaaccatgcattctcgtcaag
ctcaacagaattatcggcttcaaacctaaggcgccagaaaatgagagcctcccctcagat
cttgcaggaaaatacaacccctatctcatccctgtccactgtgttgccaagagggacgag
gacgcagacaagatcggcatggtggagtactacgggatgggcggttacccgggctttgcc
ctgcagtactacccgtactacggcaggctcctccagccgcagtacctgcagccactggtg
gcagtgcagttcaccaacctgacctatgacgtggaagtgcgcgtggaatgcaaggaatat
gggcagaacatccagtacagcgacaaagaccgcttccagggacgctttgatattaaattt
gacataaaaagcagctga

KEGG   Gallus gallus (chicken): 396530
Entry
396530            CDS       T01006                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1 precursor
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396530 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    396530 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396530 (ATP1A1)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     396530 (ATP1A1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396530 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   396530 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   396530 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   396530 (ATP1A1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 396530
NCBI-ProteinID: NP_990852
CGNC: 49857
Ensembl: ENSGALG00000032247
UniProt: P09572
Position
1
AA seq 1021 aa
MGKGAGRDKYEPTATSEHGTKKKKAKERDMDELKKEISMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNTLTPPPTTPEWVKFCRQLFGGFSLLLWIGSLLCFLAYGITSVME
GEPNSDNLYLGVVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVVRNGEKMSINA
EGVVVGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDFSNENPLETRNI
AFFSTNCVEGTAVGIVISTGDRTVMGRIASLASGLEGGKTPIAMEIEHFIHLITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVGTLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSATWLALS
RIAGLCNRAVFQANQENVPILKRAVAGDASESALLKCIELCCGSVKEMRERYPKVVEIPF
NSTNKYQLSIHKNANAGESRHLLVMKGAPERILDRCDSILIHGKVQPLDEEIKDAFQNAY
LELGGLGERVLGFCHLALPDDQFPEGFQFDTDEVNFPVEKLCFVGLMSMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISDGNETVEDIAARLNIPVSQVNPRDAKA
CVVHGSDLKDMTSEQLDDILLHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTCTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPSGLVGIRLQWDDRWINDVEDSY
GQQWTFEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFLYDEIRKLIIRRNPGGWVERETY
Y
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggggaagggggctggaagagacaagtatgagcctactgctacatcagaacatggcaca
aagaagaaaaaggcgaaggagagggacatggatgagcttaaaaaagaaatctctatggat
gaccacaagctcagccttgatgaacttcatcgtaaatatggaacagacttgagtcggggt
ttgactactgcacgtgcagctgagattttggctcgtgatggcccaaatacccttacacct
ccacccaccactcctgaatgggtcaagttctgtcggcagctctttggaggattctcactc
ctgttgtggatcggttcccttctgtgttttctggcttatggcattacaagtgtgatggag
ggagagccaaatagtgataacctgtacctaggtgttgtgttggcagctgtggttatcatt
actggctgtttctcatattaccaagaagcgaagagttcgaagatcatggagtcgttcaag
aacatggtgcctcagcaagctcttgtagtcagaaatggtgagaagatgagcataaatgct
gaaggtgttgtagttggagatctggtagaggtgaaaggaggagacagaattccagctgat
ctccggatcatatctgcacatggttgcaaggtggataactcctcgcttactggtgagtca
gagcctcagaccaggtctccagatttctccaatgagaacccactggaaactaggaacatt
gccttcttttccaccaactgtgtggaaggcactgccgtgggcattgttattagcactgga
gaccgcactgtgatgggccgtattgccagtctggcatctggactggaagggggtaagact
cccattgccatggagattgagcactttatccacctcatcactggagtagctgtgttcctt
ggtgtcagcttcttcatcctttcacttatccttgagtacacttggctggaggctgtcatc
ttcctcattgggatcattgtggccaatgtacctgagggattgctcgcaactgtaacggta
tgtctgacactaacagccaagcgtatggctcgtaagaactgcttggtgaagaacctggaa
gctgtgggaactctaggctccacatccaccatctgttctgacaaaacaggcaccctgaca
caaaatcgcatgacagttgcacacatgtggtttgacaatcagattcatgaggctgacact
acagagaaccagagtggtgcttcctttgacaagagctcagctacttggctggctttgtct
agaattgcaggtctctgcaaccgtgctgtgtttcaggccaaccaggaaaacgtaccaatc
cttaagagagcagtagcaggagatgcctctgaatctgcacttctgaaatgcattgaactg
tgctgtggttctgtgaaagaaatgagagaaaggtatcccaaagtggtcgaaataccattt
aactctaccaataagtaccagctgtctatccacaagaatgcaaatgcaggagaatctcgt
cacttgctggtgatgaagggagctccagagaggatcttggatcgctgcgacagcattctt
attcatgggaaagtgcaacccttggatgaggaaattaaagatgcttttcagaatgcctac
ctagagctggggggtcttggggagagagtactgggattctgtcacttggctctgcctgat
gaccagttccctgaaggcttccagtttgacacagacgaagtaaactttcctgtagaaaaa
ctctgctttgtaggattgatgtctatgattgaccctcctcgtgctgctgtgccggatgct
gttggcaaatgcaggagtgctgggattaaggttatcatggttactggagaccatccgatc
acagccaaagccattgccaagggagttggcatcatctctgacggcaacgaaacagtggaa
gatattgctgctcgactcaacattcctgtcagccaggtcaacccgagggatgctaaggca
tgtgttgttcatggctctgatttaaaagacatgactagtgagcaactggatgacatcctg
cttcaccatacagaaatagtctttgccaggacatctcctcagcagaagcttataattgtg
gaaggctgtcagcgccagggtgccattgtagcagtcacaggtgatggtgtgaatgattcc
ccagccctgaagaaggcagacattggtgttgctatgggtattgctgggtcagatgtctcc
aagcaagcagctgacatgattctgctggatgataactttgcctctattgtcactggggtt
gaagaagggcgcctgatctttgataacctgaagaagtcgattgcttacaccttgaccagt
aacattcctgaaatcacacctttcctgatcttcatcattgcaaacatacctctcccactg
ggaacatgcaccatcctctgcattgacttgggcactgacatggtccctgctatctccctg
gcatatgagcaagcagagagtgacatcatgaagaggcagccaagaaatcccaaaacagac
aagctggtgaatgagaggctgatcagcatggcctatgggcagattggtatgatccaggcc
cttggaggtttcttcacctattttgtaatcatggcagagaatgggttcttgccttctggg
ctagtagggattagacttcagtgggatgaccgatggattaatgatgttgaagacagctat
ggacagcaatggaccttcgaacagaggaaaattgtggaattcacttgccatacagccttc
tttgtcagcattgtggttgtgcagtgggcagacttgattatttgtaagacccgaagaaac
tctgttttccagcaggggatgaagaacaagatcctaatatttggtctcttcgaggagact
gctctagctgcattcctgtcctactgccctgggatggatgttgctctaaggatgtacccc
ctcaagccaacctggtggttctgtgccttcccgtactccctcctcatattcctctatgat
gaaatcagaaagctcattatcagacgcaaccctggtggttgggtggaaagagagacctac
tactaa

KEGG   Gallus gallus (chicken): 396549
Entry
396549            CDS       T01006                                 

Gene name
ATP1B3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396549 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    396549 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    396549 (ATP1B3)
CD molecules [BR:gga04090]
 Proteins
  396549 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 396549
NCBI-ProteinID: NP_990866
CGNC: 1995
Ensembl: ENSGALG00000002764
UniProt: P33879
Position
9
AA seq 280 aa
MSKETKKPFRQSVAEWRQFVYNPNSGEFLGRTAKSWGLILLFYLVFYGFLAALFTFTMWV
MLQTLSNDIPKYRDRISSPGLMISPKPDTALEFYFNKSDAQSYAEYVSTLRKFLETYDDS
KQSQNINCTPGKVFDQNDVAVKKACRFNLSELGQCSGKEDKTFGYSKGTPCVLVKMNRII
GLKPEGEPYIQCTSKEPGAVEINYFPSGGLIDLMYFPYYGKTLHAHYLQPLVAVQLAINS
NSTNEEIAIECKILGSPNLKNEDDRDKFLGRIAFKVEMTE
NT seq 843 nt   +upstreamnt  +downstreamnt
atgagcaaggagacgaagaagccgtttcgccagagcgtggccgagtggcggcagttcgtc
tacaaccccaacagcggcgagttcctggggcgcacggccaagagctggggtttgatctta
ttattctatctggtattttatggcttcctcgcggcgctcttcacattcacaatgtgggtt
atgcttcagacactgagcaatgacattccaaaataccgtgaccggatttctagtccaggg
cttatgatttcaccaaagccagacactgcactggaattctactttaacaagagtgacgcc
cagtcatatgcagaatatgtttctacacttagaaaatttcttgaaacatatgatgattca
aagcaatcccaaaatataaactgtacaccaggaaaggtttttgatcagaatgatgttgct
gttaaaaaagcatgtcgatttaacctctctgagcttgggcagtgctctggaaaggaagat
aagacctttggctattctaaaggaactccctgcgtgcttgtgaaaatgaataggataatt
ggattaaagcctgaaggggaaccgtatatacagtgtacatctaaggaaccaggcgcggtt
gagataaattattttccttcaggaggcttgattgacttgatgtactttccatactatggg
aaaaccttgcatgctcactatttacagcctctagtggctgttcaactagcgattaactcc
aacagtaccaatgaagaaatagcaattgagtgtaagatcctgggctcacctaatttaaaa
aatgaagatgatcgtgacaagtttctgggacgaattgccttcaaagttgagatgactgaa
tag

KEGG   Gallus gallus (chicken): 419770
Entry
419770            CDS       T01006                                 

Gene name
FXYD2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit gamma
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    419770 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    419770 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    419770 (FXYD2)
   04147 Exosome [BR:gga04147]
    419770 (FXYD2)
Transporters [BR:gga02000]
 Other transporters
  Pores ion channels [TC:1]
   419770 (FXYD2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   419770 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 419770
NCBI-ProteinID: NP_001289113
CGNC: 14500
Ensembl: ENSGALG00000007320
Position
24
AA seq 61 aa
MGDEQAPEQGPDRFTYDYETIRYGGLIFAIVAFVVGLLIILSQRFHCGGKKKRRQGNGED
L
NT seq 186 nt   +upstreamnt  +downstreamnt
atgggggacgagcaagcacccgagcagggcccggacaggttcacctacgactatgagacc
atccgctacggggggctgatcttcgccatcgtggcttttgtggtcgggctcctcatcatc
ctcagccagcggttccactgcggagggaagaagaagagaagacaaggaaacggggaggac
ctgtag

KEGG   Gallus gallus (chicken): 422365
Entry
422365            CDS       T01006                                 

Gene name
ATP1B4
Definition
(RefSeq) protein ATP1B4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    422365 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    422365 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    422365 (ATP1B4)
CD molecules [BR:gga04090]
 Proteins
  422365 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 422365
NCBI-ProteinID: NP_001038116
CGNC: 6519
Ensembl: ENSGALG00000008593
UniProt: Q2HZ96
Position
4
AA seq 321 aa
MEPGMEMNTASEGGTRRGPENKHEEKVQDPNRGEAETKAEMGNKTWADLAGEMKTFLWNP
EERTCMGRTAKSWGLILLFYFIFYTCLAGMFAFCMYVMLLTLSPYTPTYRDRVSPPGVMI
RPYLNGFTIAFNVSKPSTWQPYVDSMHQFLAAYDDKVQEEKNIECISGQYFIQGGNDSEE
KKACQFKRSLLQNCSGIEDPTFGFSKGQPCILLKMNRIIGYRPGAGVPVNVDCKVQKGNE
SDLRSVDFYPGNGTFDLMYYPYYGKLTHVNYTSPLVAMHFTDVKRNSLVHIQCKLNGKGI
INDVNSDRFLGRIIFTLSIGK
NT seq 966 nt   +upstreamnt  +downstreamnt
atggagccggggatggagatgaacacagcctctgagggaggcacccgccgggggccggaa
aataagcatgaagaaaaagtgcaggatcccaacagaggggaggcagagaccaaggcagag
atggggaacaaaacatgggcagacctggccggggagatgaagactttcctgtggaaccca
gaggagagaacctgcatggggagaacagccaagagctggggcctgatcttactgttctac
ttcatcttctacacgtgcctggcggggatgttcgccttctgcatgtatgtgatgctgctc
accctgagcccctacacacccacctaccgggaccgtgtgtctccgccaggagtaatgatc
agaccatacctgaatggctttactattgccttcaacgtctccaagcccagcacttggcag
ccatatgtggacagcatgcaccagttcctagcagcttacgatgacaaagttcaagaggag
aagaacattgagtgcatctcaggacagtacttcatccaaggaggcaacgacagcgaggag
aagaaggcctgccagttcaagcgctcactgctgcagaactgctcagggattgaggatccg
acatttggcttctctaagggccagccctgcatcctgctgaagatgaaccggatcataggc
taccgtcctggtgctggggtccctgtgaatgtggactgcaaagtgcagaaaggcaatgag
agcgatctgaggtcggtggacttctaccctgggaacggcacatttgacctcatgtattac
ccctactatggcaagctcacgcacgtcaactacacgtcccccctggtggccatgcacttc
acagatgtgaagaggaatagtttggtccacattcagtgcaagctgaacgggaaagggatc
atcaatgacgttaacagcgaccgcttcctgggccggatcatcttcacactcagcattgga
aagtag

DBGET integrated database retrieval system