KEGG   Gallus gallus (chicken): 107051305
Entry
107051305         CDS       T01006                                 

Definition
(RefSeq) sodium channel subunit beta-1
  KO
K04845  voltage-gated sodium channel type I beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107051305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    107051305
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107051305
SSDB
Motif
Pfam: V-set Ig_3 GAP1-M
Other DBs
NCBI-GeneID: 107051305
NCBI-ProteinID: XP_025002216
CGNC: 74314
Position
Unknown
AA seq 219 aa
MAFCGPALLLLGLLMAPGVQGGCVEVDSETEAVLGAPFKLLCIACKRRSETPAEAEGEWF
FRAEGAPEFTKILHYTAEEGAWVAPGPFEGLLFWNGSRGTRDIQDLSVRLSNVGRSHAGL
YVCRLRRNLTFEGYTYSLARNKSVKLAVVESERRDLASIVSEVLMYVLIVLLTLWLAAEM
LYCYRKVAAASAPPPDSASEYLAITSESKENCAGVQVAE
NT seq 660 nt   +upstreamnt  +downstreamnt
atggccttctgcggccccgcgctgctcctcctcggccttctgatggccccgggggtgcag
gggggctgcgtggaggtggattcggagacggaggctgtgctgggagccccattcaaactg
ctgtgcatcgcctgcaagcggcgcagtgagacccccgcagaggctgagggggagtggttc
ttccgggctgagggagcccccgaattcaccaagatccttcactacaccgcagaggagggc
gcctgggtggccccgggccctttcgaagggctgctgttctggaatggctcccgcggcact
cgggacattcaggacctgtccgtccgtctgtcgaacgtggggcggtcccacgccgggctc
tacgtctgccgcctgcgccggaacctcacctttgagggctacacctacagcctggcccgc
aataagagcgtgaagctggccgtggtggagagcgagcgccgggacctggcgagcatcgtg
tcggaggtgctgatgtacgtcctgatcgtgctgctcaccctttggctggcggccgaaatg
ctgtactgctataggaaggtggcggccgcctccgcaccgcccccggacagcgcctccgag
tacctggccatcacctccgagagcaaggagaactgcgcgggggtgcaggtggccgagtag

KEGG   Gallus gallus (chicken): 395947
Entry
395947            CDS       T01006                                 

Gene name
SCN5A
Definition
(RefSeq) sodium channel protein type 5 subunit alpha
  KO
K04838  voltage-gated sodium channel type V alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395947 (SCN5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395947 (SCN5A)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   395947 (SCN5A)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel GPHH IQ CcmD_alt
Other DBs
NCBI-GeneID: 395947
NCBI-ProteinID: NP_001305375
CGNC: 49568
Ensembl: ENSGALG00000006112
UniProt: F1N8I1
Position
2
AA seq 2038 aa
MADFLLPPGTNSFHRFTPESLAAIEKRIAEKLARNAKQEYREQLGEEEKPQPQFDLQACK
KLPDIYGTVPPELIGEPLEDIDPFYNDRKTFVVLNKGKTIFRFSATPALYILSPFHPVRR
AAIKILLFTLFSMFIMCTILTNCVFMAQSETPSWNKYVEYTFTGIYTFESLIKILARGFC
MTEFTFLRDPWNWLDFSVIVMAYITEFVDLGNVSALRTFRVLRALKTISVISGLKTIVGA
LIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRHKCVRDYTQFNFTNGSLYLDGRTWN
NSEEFLNDPVNYFIKNGTEDVLLCGNSTDAGTCPEGYICLKAGENPDHGYTSFDTFGWAF
LSLFRLMTQDYWERLYQQTLRSAGKIYMLFFMLVIFLGSFYLVNLILAVVAMAYEEQNQA
TIAETEEKERKFREAMEMLKKEQEALAAKGIDSMSLSSLEMSPLASKNAKERRNRRKKKK
SLGAEEYGEDQRNSKCEYDDSQRRMTLLGISYGPSANLVKRRTSHGSIFSFRLRGRDTGS
ETDFADDEISTAGENESHRGSLLIPRSGRRPSIQSQVSHSSHPTTPNYTQTGKRNSSVDC
NGVVSLIGGGTGALNPDPTSPAGLLLPPFIMEKPGTGDLTSPSDEASKKQLLMPHRPSVD
HSDEPFQRQRAVSAVSIITSALEELEESHQKCPPCWNHFAVKFLIWDCCPFWLLIKKFVK
FVVMDPFTDLTITLCIVLNTLFMALEHYKMTKEFDHMLYIGNLVFTGIFTAEMIFKVIAL
DPYYYFQQGWNIFDSIIVILSLMELGLSSMGNLSVLRSFRLLRVFKLAKSWPTLNTLIKI
IGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYLDNVKKISTTGNLPRWHMNDFFHSFL
IIFRILCGEWIETMWDCMEVAGQPLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLSA
PDEDGEMNNLQLAFARINRGLQYVKHTTWDFCCNVLRHPKTTAEKKAMMKLAAQNTGALN
NCVNSHPTAELGKEMENHKENHTEDGTNKNVEKHLGITDNDDFMTNPDLSICVPIAVGES
DIEEEDEEQSTFTEMEQDYFQQEKQLQLRGQRCQSPGARSQNSEICEELSELHVDKQLKA
EPPPPNTAPFDNKLDEISLSEGSTVDLTNPAELLEQIPEFAEELMEPEDCFPEVCVRFFP
CCSVDISKFPGKIWWRLRKTCYRIVEHNWFETFIIFMILLSSGALAFEDIYLEDRKNIKT
MLEYADKIFTYIFVLEMLLKWVAYGFKKYFTNAWCWLDFLIVDVSLISLIANTLGYSEMG
PIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFA
GKFGKCINKTEGDMPLDSKIINNMTDCILYNVSGTFYWTKVKVNFDNVGAGYLALLQVAT
FKGWMDIMYAAVDSRECEEQPEWECNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQK
KKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKYQGFIFDVVSKQAFDVSIMIL
ICLNMVTMMVETDDQSQEKVNILHKINMLFVAIFTGECIFKMLALRHYYFTNGWNIFDFV
VVILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPAL
FNIGLLLFLVMFIYAIFGMANFAYVKKEYGIDDMFNFQTFANSMLCLFQITTSAGWDGLL
NPILNTGPPYCDPNLPNANGSKGDCGSPAVGILFFVTYIIISFLIVVNMYIAIILENFSV
ATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSALSDFADALSEPLRIAKPNKIKLIA
MDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLR
RKQEEVSAIVIQRAYRRHLFRRSMKQASYLYRHRTFDGSILEDDAPEKEGLIAFMMNENY
GRPIDKSETLSSTSFPPSYDSVTRGTSENLQLKLTDSSRTDEAIDCLLSPDRDKESIV
NT seq 6117 nt   +upstreamnt  +downstreamnt
atggctgacttcttgttaccaccgggtactaacagcttccaccggttcacgcccgaatcc
ttggctgctattgagaagcgaattgcagagaagcttgcaaggaatgcgaagcaggagtac
agagagcagctgggcgaagaggaaaagcctcagcctcagtttgatttgcaagcgtgcaag
aagctgcctgatatctatgggactgttcctccagagcttattggagagccactggaggac
attgaccccttctacaatgatcgcaagacatttgtagtactgaacaaagggaagacaata
tttcgatttagtgccactcctgccttgtatatacttagtcctttccatccagtcagaaga
gcagcaattaaaattttgctatttacattgttcagtatgtttattatgtgcactatttta
actaattgtgtgttcatggcacaatcagagactccatcatggaataaatatgttgagtac
actttcactggcatttacacttttgagtcattgataaaaatattggcgagaggattttgc
atgacagaattcaccttccttcgagatccatggaactggctggatttcagtgttatcgtt
atggcatacataactgaatttgtggacctgggcaatgtctcagccttgcgaacgttcaga
gtactgcgggcgctgaaaacaatctcagtcatttcaggactgaagaccattgtaggtgca
cttatccagtctgttaagaaacttgctgatgtgatgatcctgaccgttttctgcttgagt
gtctttgccctcataggcctccagctctttatgggcaacttgcgacacaagtgtgtgagg
gactacacccagttcaacttcaccaacggctcgttgtacttggatggcaggacatggaac
aactcagaggaatttcttaacgatccagtaaactacttcataaagaacggtacggaagat
gtgttactgtgtggcaatagcactgatgctggcacctgccctgagggatacatatgtctg
aaggccggggaaaatcctgaccatggttacacaagctttgatacttttggctgggccttt
ctctctctgttccgtcttatgactcaagactattgggaacgcctctaccaacagactctc
agatctgctgggaagatctacatgctcttttttatgctggtcatcttcctgggctcgttt
tatctggtcaacctgattctggctgtggtggccatggcatatgaagagcagaaccaagcc
actattgctgaaacagaagaaaaggaaagaaagtttcgggaagccatggagatgttaaag
aaagagcaggaggcactagctgctaaagggattgactcaatgtcacttagctccctggaa
atgtcacctttagcatccaagaatgccaaggaaagaagaaacaggagaaagaaaaagaaa
tctttgggagcagaagaatatggggaagaccagaggaattccaagtgtgaatatgatgac
agtcagaggagaatgactctccttggcattagttatggtcccagtgcaaacttggtgaag
cgcagaaccagccacggaagcatattcagtttccgactccgtggtagagacactggctcc
gaaacagattttgccgatgatgagatcagcaccgctggggaaaatgaaagccaccggggc
tctctcttaattccaagatctgggagacgtccgagcattcaaagtcaagtgagccatagt
tctcaccctactactcccaactacacccagacgggcaaaaggaacagctcagtggattgc
aatggtgtggtttccctgataggaggaggcaccggggcactcaacccagaccctacttct
cctgcagggttactgctccccccatttattatggaaaaacctgggacaggcgatctgacc
tctccctcagatgaggccagcaagaagcagcttttaatgccccatcgcccatcggtggac
cactcagatgagcccttccagagacagagggcagtgagtgctgtcagcatcatcaccagt
gccctggaagagcttgaggaatcacaccagaaatgccctccatgctggaaccactttgct
gttaaatttctcatttgggattgctgcccgttttggcttttaatcaagaaatttgtcaag
tttgtggtaatggacccatttactgacctcaccatcaccctctgcattgtgctgaacaca
ctcttcatggcgttggagcattataagatgacaaaggagtttgaccacatgctttacata
ggcaatttggtcttcactgggatttttacagcagaaatgatcttcaaagtaattgccctt
gacccttactactattttcagcagggctggaacatttttgacagcataattgttatactg
agcctgatggaactgggtttatccagcatggggaacctgtctgtgttacgctcctttcga
ttgctgcgggtcttcaaattggccaagtcgtggccgaccttaaacacgctcattaaaatc
atcggtaattccgtgggcgccctcgggaacctcacccttgtgctggcaatcatcgtcttt
attttcgccgtggtaggaatgcagctttttgggaagagctacctggacaacgttaagaag
ataagcacaactggcaatttgccacgctggcacatgaacgatttcttccattcgttcctc
atcatcttccgaatcctatgcggagagtggatcgagaccatgtgggactgcatggaagta
gctgggcagcccctgtgccttctcgtcttcttgttggtcatggtgataggaaacctggtg
gtgctcaacctgttccttgccttgctgctcagctctttcagtgctgacaacctttcggca
ccagacgaggatggagagatgaacaacctgcagcttgcctttgctcggatcaacaggggt
cttcagtatgtgaaacacaccacgtgggatttttgctgcaacgtcctccggcatcccaag
acaacagctgagaagaaggcaatgatgaagcttgctgcccagaatacaggtgcccttaac
aattgtgtcaacagccacccaactgctgagcttggcaaagagatggagaatcacaaagag
aaccacacagaggatgggacgaataaaaatgtggagaaacacctgggaattacagacaac
gatgactttatgaccaatcctgacctatcaatttgtgttcctattgctgtgggagagtct
gatatcgaggaggaagatgaggagcaaagcacgtttacagaaatggagcaggattatttc
cagcaggaaaagcagctgcagctgagggggcagcgatgccaaagcccaggcgcccgaagt
cagaactctgagatttgtgaagagttaagtgagttgcacgtggataagcagttgaaggct
gagccaccacctccaaacactgctccatttgacaacaagcttgatgaaatcagtctttct
gaaggcagcacagtggatttgacaaatcctgcagaactgctggagcagatccctgagttt
gctgaggagctgatggagcctgaagattgcttccccgaagtttgtgtgcggttcttccca
tgctgttccgtggacatctcaaaatttccaggcaaaatttggtggaggctccggaagact
tgctacaggattgttgaacacaactggtttgagactttcatcatattcatgatcttgctg
agcagtggagccctggcttttgaagatatttaccttgaagatcgaaaaaacataaaaacc
atgctggaatatgctgacaaaatattcacttacatctttgtattggaaatgctcctgaaa
tgggtggcttatggcttcaagaagtatttcaccaacgcctggtgctggcttgacttcctc
attgtcgatgtctccttaatcagcctcatagccaacactcttggatactccgagatgggt
cccattaaatccctcaggaccctccgagctctgagaccactgagagcgttgtcacggttt
gaagggatgagggtggtggtcaatgcccttgtgggagccatcccttccatcatgaacgtt
ctgctcgtctgcctcatcttctggctcatctttagcatcatgggagtcaacctgtttgct
gggaagtttgggaagtgcattaataagacagaaggagatatgcctttagactctaaaatt
attaacaacatgactgactgcatactctataatgtttctggcacattttactggacaaaa
gttaaagttaactttgacaacgttggcgctgggtacctggctctcctgcaggtggccaca
tttaaaggttggatggatattatgtatgcagcagtggattcacgagagtgtgaggagcag
cctgaatgggaatgtaatttatacatgtacctgtactttgtgattttcatcatcttcggg
tctttcttcacactgaacctcttcattggtgtcatcattgacaatttcaaccaacagaag
aaaaagttaggtggccaggacatctttatgacagaagaacagaaaaagtattataatgca
atgaaaaagttgggttctaagaaacctcaaaagccaatcccaagaccactgaacaaatac
caaggttttatttttgatgttgtctcaaaacaagcctttgatgtctccatcatgattctc
atctgccttaacatggttaccatgatggtagaaacggatgatcaaagtcaggaaaaagtg
aacatcctccacaaaatcaacatgctttttgttgccatcttcactggggagtgcatcttc
aaaatgctggcactacgacactactacttcaccaatggttggaacatctttgactttgtc
gttgtgattctgtctattgtaggcactgtactttctgacatcattcagaaatactttttc
tctcccacactcttcagagtcattcgcttggctcgaattggccggatcctaagactcatc
cggggagccaaaggaattcgaactctcctttttgccttaatgatgtccctacctgctctg
ttcaacattggcctcttgctttttctggtcatgttcatttatgccatttttggcatggct
aactttgcctatgttaagaaggagtatgggattgatgacatgttcaacttccaaactttt
gctaacagcatgctctgtctcttccaaatcacaacgtcagctggctgggatggtcttctc
aaccctattttgaacactggaccaccatattgcgacccaaaccttccaaatgcaaatggt
tcaaagggagactgtggaagtcctgccgtagggattttattctttgttacttatatcatt
atatcatttctcatcgttgtaaacatgtatatagccattattttagagaacttcagtgta
gccactgaggaaagtacagagcctctaagtgaggatgattttgatatgttctatgaaatc
tgggagaagtttgaccctgaagccactcagtttattgagtattctgcactttcagacttt
gcagatgcactgtcagaacctttgcgcatagcgaaaccaaacaaaatcaaactcatagca
atggacctgcccatggtcagcggagataggatccattgcttggatattttgtttgctttt
acaaaaagggtgctaggagaatctggggagatggatgcccttaaaatacaaatggaagaa
aagttcatggcggcaaatccatccaagatctcttatgaaccaataacaacaactctcaga
cggaaacaagaagaggtctccgccatcgtcatccagcgcgcctacaggagacatttgttt
cggcgctcaatgaagcaggcatcttacttgtaccgacacagaacttttgacggcagcatc
ctcgaggacgatgcacccgagaaggagggtctcattgcattcatgatgaatgaaaactac
ggcaggccaatagacaaatcagaaaccctgtcctccacgtccttccctccgtcctacgac
agcgttaccagaggtacaagcgagaatctccagctgaaattgacagactcgagcagaacc
gacgaggccatagattgtttgctctcaccagacagagataaagaatcaattgtttaa

KEGG   Gallus gallus (chicken): 419774
Entry
419774            CDS       T01006                                 

Gene name
SCN4B
Definition
(RefSeq) sodium channel subunit beta-4 isoform X1
  KO
K04848  voltage-gated sodium channel type IV beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    419774 (SCN4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    419774 (SCN4B)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   419774 (SCN4B)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 V-set_CD47 Glycophorin_A Ig_6 Collectrin
Other DBs
NCBI-GeneID: 419774
NCBI-ProteinID: XP_015153740
CGNC: 5593
Ensembl: ENSGALG00000007409
Position
24
AA seq 345 aa
MHGCVPICGCSDAQRLPGAGTAPLGWALGESPARFGRFPDGRRESTRRRAASVRAPRPGG
WAERGAPQGAGDTDGRGDTAGRGSAPPPPPPGAAPPGSARPRRGRPEPGAAGSRDAPQPW
PRACWPRCWAGVRSAEDKWFGQGLYILAIAFALEVSVGKTNTVMALNGSDILLPCTFTTC
IGFQDLIFTWYFNSTELIYHGKIKSKTSEPILVGRNPRVEFVGSTTGKDNNISIVLKDVE
LSDAGRYTCHVLNPKEKKAHNATIFLTVVHKLEETDNTVTLIIVGVVGGLIGLLILFMLV
KRVVLFIIKKIQDGKKECLVSSSGNDNTENGLAGSKAEQKAPPKA
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgcacggctgcgtccccatctgcggctgcagcgacgctcagcgcctccctggggctggc
acagcgccgctggggtgggcgctgggtgagagcccggcccggtttggccgttttccggac
ggaagaagggaaagcacccgccgcagggctgcatccgtgcgagctccgaggccgggcggg
tgggcggagcggggggccccgcagggtgcgggggacaccgatggacgcggggacacggcg
gggcggggctcggcgcctcctcctcctcctcccggcgcggctccgcccggttcggctcgg
cctcggcgggggcggccggagccgggcgctgcgggcagtcgggacgcgccgcagccatgg
ccccgcgcctgctggccgcgctgctgggcgggagtccgaagcgctgaggataagtggttc
ggccaaggtctgtacatcctcgccattgccttcgccctggaggtgtcggtggggaaaacc
aacactgtgatggctctgaacggctccgacatcctgctgccctgcaccttcaccacctgc
attggcttccaggacctgatcttcacgtggtacttcaactcaacggagctgatctaccac
ggcaagatcaagagcaaaacctctgagcccatcctcgtgggacgcaacccgcgggtcgag
ttcgttggctccaccactgggaaggacaacaacatctccatcgtcctgaaggatgtagag
ctcagcgatgccggcaggtacacctgccatgtcctcaaccccaaggagaagaaggctcac
aatgccaccatcttcctcaccgtggtccataagttggaggagacagacaacacggtgacg
ctcatcatcgtgggtgttgtgggaggactcatcggcctcctcatcctcttcatgcttgtc
aagagggtcgtcctcttcatcatcaagaagatccaggatgggaagaaggagtgcctcgtc
agctcctcgggcaacgacaacacggagaacggcctggcgggctccaaggcggagcagaaa
gcgcccccgaaggcatga

DBGET integrated database retrieval system